Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H7K6

Protein Details
Accession A0A1X2H7K6   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
438-457LAEKEKRKANKKAYMYDPLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027640  Kinesin-like_fam  
IPR019821  Kinesin_motor_CS  
IPR001752  Kinesin_motor_dom  
IPR036961  Kinesin_motor_dom_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0005874  C:microtubule  
GO:0005524  F:ATP binding  
GO:0008017  F:microtubule binding  
GO:0003777  F:microtubule motor activity  
GO:0007018  P:microtubule-based movement  
Pfam View protein in Pfam  
PF00225  Kinesin  
PROSITE View protein in PROSITE  
PS00411  KINESIN_MOTOR_1  
PS50067  KINESIN_MOTOR_2  
Amino Acid Sequences MQMGDQDQPGVIPRAVDDVFAFIEQDLDRREYMLRVSYLEIYNEQIRDLLSCNPSHENLKVVEQDSRMVVQGLIEEKVATRAEVLAIIKRGENNRHVGATDYNAHSSRSHAIFQMVVESRSKSRNVVRISQLNLIDLAGSEKATTDKNRLTEGRYINRSLLTLGNVIASLTNKKRRNTHVPYRDSILTRVLQTALSGNARISVICTVNPTTACKDESMNTLRFAQHAKQVQTSAKTTRISEHSVLQECLRTIADLQSKVREKDDQEAETHMRLARLMSLVLTSSKQEASTLIPNDMQNAFLSNGGMPNIELTSDLFARCEEHLTATLQEKEGLAMAMAKIADEKQALEVSMHEKDVLVSALTHSLREKEELISALSAALKQKDEDIAQKENHLSQKESHLSLFITAADNLQRELEDSKRREAETTQALKDAQSALDALAEKEKRKANKKAYMYDPLLPAGPWTFVFALVIYAWAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.16
5 0.15
6 0.16
7 0.15
8 0.15
9 0.1
10 0.13
11 0.12
12 0.15
13 0.16
14 0.17
15 0.17
16 0.18
17 0.2
18 0.18
19 0.21
20 0.24
21 0.22
22 0.21
23 0.24
24 0.27
25 0.27
26 0.28
27 0.26
28 0.24
29 0.27
30 0.25
31 0.23
32 0.19
33 0.17
34 0.17
35 0.18
36 0.2
37 0.2
38 0.21
39 0.24
40 0.27
41 0.29
42 0.32
43 0.31
44 0.27
45 0.26
46 0.29
47 0.3
48 0.29
49 0.3
50 0.28
51 0.28
52 0.27
53 0.26
54 0.21
55 0.17
56 0.16
57 0.12
58 0.14
59 0.14
60 0.13
61 0.12
62 0.11
63 0.11
64 0.14
65 0.14
66 0.11
67 0.1
68 0.1
69 0.1
70 0.13
71 0.14
72 0.14
73 0.16
74 0.17
75 0.17
76 0.21
77 0.26
78 0.29
79 0.33
80 0.34
81 0.35
82 0.35
83 0.34
84 0.32
85 0.29
86 0.27
87 0.27
88 0.24
89 0.24
90 0.24
91 0.25
92 0.23
93 0.24
94 0.26
95 0.23
96 0.23
97 0.2
98 0.21
99 0.2
100 0.2
101 0.24
102 0.2
103 0.18
104 0.18
105 0.19
106 0.21
107 0.24
108 0.25
109 0.23
110 0.28
111 0.34
112 0.37
113 0.42
114 0.46
115 0.48
116 0.51
117 0.51
118 0.45
119 0.38
120 0.34
121 0.26
122 0.2
123 0.14
124 0.12
125 0.07
126 0.06
127 0.06
128 0.06
129 0.07
130 0.11
131 0.13
132 0.17
133 0.2
134 0.22
135 0.27
136 0.28
137 0.3
138 0.35
139 0.4
140 0.42
141 0.42
142 0.42
143 0.39
144 0.37
145 0.34
146 0.28
147 0.23
148 0.16
149 0.13
150 0.11
151 0.1
152 0.09
153 0.09
154 0.08
155 0.08
156 0.12
157 0.17
158 0.26
159 0.31
160 0.35
161 0.42
162 0.49
163 0.59
164 0.63
165 0.68
166 0.69
167 0.69
168 0.67
169 0.65
170 0.61
171 0.51
172 0.43
173 0.36
174 0.27
175 0.23
176 0.21
177 0.17
178 0.14
179 0.13
180 0.12
181 0.11
182 0.1
183 0.09
184 0.08
185 0.09
186 0.09
187 0.08
188 0.08
189 0.09
190 0.09
191 0.09
192 0.11
193 0.1
194 0.12
195 0.13
196 0.14
197 0.14
198 0.15
199 0.15
200 0.14
201 0.15
202 0.14
203 0.19
204 0.22
205 0.21
206 0.2
207 0.22
208 0.21
209 0.21
210 0.22
211 0.18
212 0.19
213 0.23
214 0.23
215 0.23
216 0.26
217 0.27
218 0.27
219 0.28
220 0.25
221 0.24
222 0.24
223 0.23
224 0.23
225 0.25
226 0.26
227 0.24
228 0.25
229 0.25
230 0.26
231 0.26
232 0.23
233 0.21
234 0.17
235 0.16
236 0.13
237 0.09
238 0.08
239 0.12
240 0.15
241 0.15
242 0.16
243 0.22
244 0.25
245 0.25
246 0.26
247 0.25
248 0.23
249 0.29
250 0.33
251 0.28
252 0.26
253 0.29
254 0.29
255 0.26
256 0.25
257 0.18
258 0.14
259 0.13
260 0.12
261 0.1
262 0.09
263 0.08
264 0.07
265 0.06
266 0.07
267 0.07
268 0.08
269 0.07
270 0.08
271 0.08
272 0.08
273 0.08
274 0.09
275 0.11
276 0.16
277 0.16
278 0.16
279 0.18
280 0.18
281 0.2
282 0.19
283 0.17
284 0.11
285 0.12
286 0.11
287 0.09
288 0.1
289 0.08
290 0.08
291 0.08
292 0.08
293 0.06
294 0.06
295 0.06
296 0.05
297 0.05
298 0.05
299 0.07
300 0.08
301 0.08
302 0.07
303 0.08
304 0.1
305 0.1
306 0.11
307 0.1
308 0.11
309 0.12
310 0.14
311 0.16
312 0.17
313 0.18
314 0.16
315 0.17
316 0.15
317 0.14
318 0.13
319 0.1
320 0.07
321 0.06
322 0.06
323 0.07
324 0.06
325 0.06
326 0.06
327 0.07
328 0.08
329 0.08
330 0.09
331 0.09
332 0.1
333 0.1
334 0.1
335 0.11
336 0.13
337 0.14
338 0.14
339 0.12
340 0.12
341 0.11
342 0.12
343 0.11
344 0.08
345 0.07
346 0.07
347 0.13
348 0.13
349 0.14
350 0.13
351 0.16
352 0.17
353 0.19
354 0.19
355 0.15
356 0.17
357 0.17
358 0.17
359 0.15
360 0.14
361 0.13
362 0.11
363 0.11
364 0.12
365 0.13
366 0.12
367 0.12
368 0.14
369 0.16
370 0.18
371 0.23
372 0.26
373 0.3
374 0.3
375 0.33
376 0.33
377 0.35
378 0.39
379 0.35
380 0.32
381 0.29
382 0.38
383 0.39
384 0.39
385 0.34
386 0.3
387 0.28
388 0.26
389 0.24
390 0.16
391 0.14
392 0.12
393 0.13
394 0.14
395 0.14
396 0.14
397 0.14
398 0.12
399 0.12
400 0.15
401 0.21
402 0.28
403 0.31
404 0.38
405 0.42
406 0.43
407 0.43
408 0.42
409 0.43
410 0.44
411 0.47
412 0.41
413 0.39
414 0.39
415 0.36
416 0.37
417 0.3
418 0.2
419 0.14
420 0.13
421 0.11
422 0.14
423 0.14
424 0.13
425 0.19
426 0.22
427 0.23
428 0.29
429 0.36
430 0.42
431 0.51
432 0.6
433 0.63
434 0.69
435 0.76
436 0.79
437 0.8
438 0.8
439 0.75
440 0.7
441 0.62
442 0.53
443 0.46
444 0.36
445 0.31
446 0.23
447 0.2
448 0.15
449 0.16
450 0.15
451 0.14
452 0.15
453 0.13
454 0.13
455 0.11