Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H1W7

Protein Details
Accession A0A1X2H1W7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-101TPTLKSLPHKAIRKKKCQTMVLHRVARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 6, mito 4, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLFCQVWCFYSTGPLSLHILFPILLSYVNFICHACCCAFCVLRDAFDGYDRSIVGYDMGHARSVSYHITSMFVLTPTLKSLPHKAIRKKKCQTMVLHRVAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.21
5 0.15
6 0.14
7 0.12
8 0.11
9 0.1
10 0.07
11 0.06
12 0.06
13 0.08
14 0.07
15 0.08
16 0.09
17 0.08
18 0.09
19 0.09
20 0.11
21 0.09
22 0.09
23 0.1
24 0.12
25 0.13
26 0.13
27 0.17
28 0.16
29 0.16
30 0.17
31 0.16
32 0.13
33 0.14
34 0.14
35 0.1
36 0.11
37 0.1
38 0.09
39 0.08
40 0.08
41 0.06
42 0.05
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.09
51 0.1
52 0.09
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.1
64 0.11
65 0.12
66 0.14
67 0.2
68 0.28
69 0.36
70 0.45
71 0.53
72 0.63
73 0.71
74 0.79
75 0.83
76 0.83
77 0.84
78 0.83
79 0.82
80 0.83
81 0.83