Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HIX4

Protein Details
Accession A0A1X2HIX4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-36LYRQCFRAARQKPKENRPHFYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MPSARRSGLQTQVLNLYRQCFRAARQKPKENRPHFYAFIRREFRAHDIRRTDFATIEYMLRRGQRQLETYSSPSIQDIHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.33
4 0.27
5 0.27
6 0.28
7 0.22
8 0.24
9 0.32
10 0.4
11 0.48
12 0.55
13 0.64
14 0.7
15 0.79
16 0.86
17 0.82
18 0.79
19 0.74
20 0.7
21 0.62
22 0.58
23 0.57
24 0.49
25 0.5
26 0.48
27 0.42
28 0.37
29 0.37
30 0.37
31 0.39
32 0.38
33 0.37
34 0.39
35 0.4
36 0.42
37 0.42
38 0.37
39 0.28
40 0.26
41 0.22
42 0.17
43 0.17
44 0.14
45 0.14
46 0.16
47 0.18
48 0.18
49 0.19
50 0.24
51 0.27
52 0.3
53 0.34
54 0.37
55 0.39
56 0.41
57 0.42
58 0.37
59 0.33
60 0.3