Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HNW6

Protein Details
Accession A0A1X2HNW6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
45-65YDKPKRHWPSKNKHIGKAKLKBasic
NLS Segment(s)
PositionSequence
48-66PKRHWPSKNKHIGKAKLKL
Subcellular Location(s) mito 12, mito_nucl 10.5, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
Pfam View protein in Pfam  
PF00168  C2  
Amino Acid Sequences MRVKMGSAQYFSRRATSHHGDWNEGFVFIVSYHAQLFDTIEFDLYDKPKRHWPSKNKHIGKAKLKLSKLEGRDDIFVTQVVSDHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.4
4 0.4
5 0.43
6 0.43
7 0.42
8 0.42
9 0.42
10 0.34
11 0.27
12 0.21
13 0.13
14 0.12
15 0.09
16 0.11
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.07
23 0.08
24 0.06
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.08
31 0.09
32 0.15
33 0.15
34 0.18
35 0.26
36 0.32
37 0.4
38 0.47
39 0.56
40 0.61
41 0.71
42 0.8
43 0.77
44 0.79
45 0.81
46 0.81
47 0.79
48 0.77
49 0.74
50 0.71
51 0.68
52 0.63
53 0.61
54 0.59
55 0.53
56 0.52
57 0.47
58 0.42
59 0.43
60 0.4
61 0.34
62 0.27
63 0.24
64 0.17
65 0.14