Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HMR9

Protein Details
Accession A0A1X2HMR9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
178-204NDGESSRKKRKTAEKKEKKSKKKSQKABasic
NLS Segment(s)
PositionSequence
184-204RKKRKTAEKKEKKSKKKSQKA
Subcellular Location(s) nucl 19.5, cyto_nucl 17.333, mito_nucl 11.164, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013240  DNA-dir_RNA_pol1_su_RPA34  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0006360  P:transcription by RNA polymerase I  
Pfam View protein in Pfam  
PF08208  RNA_polI_A34  
Amino Acid Sequences MSIEIQTNGIPDGFLPCDGSVSSKLTLSSVKDDDKELWLIRIPDNVSPEQLAGMKIKVPSSSQKSLGKLKQGDDTFVLHNLPNGEAQDEDSGISGQEMQQFTCLLPRRKDGDEMSLASKPFKQHLILSQQVDIPDVTQIGKALLDTPVAKRPQPEGLKMRYKPIGFREPSDDEETGDNDGESSRKKRKTAEKKEKKSKKKSQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.13
5 0.14
6 0.16
7 0.15
8 0.17
9 0.17
10 0.16
11 0.17
12 0.17
13 0.2
14 0.19
15 0.23
16 0.24
17 0.26
18 0.26
19 0.28
20 0.28
21 0.28
22 0.29
23 0.24
24 0.21
25 0.21
26 0.22
27 0.21
28 0.24
29 0.22
30 0.22
31 0.25
32 0.24
33 0.22
34 0.21
35 0.2
36 0.16
37 0.16
38 0.14
39 0.11
40 0.11
41 0.12
42 0.13
43 0.14
44 0.14
45 0.15
46 0.22
47 0.28
48 0.31
49 0.34
50 0.38
51 0.41
52 0.48
53 0.49
54 0.49
55 0.45
56 0.43
57 0.44
58 0.4
59 0.38
60 0.31
61 0.3
62 0.23
63 0.21
64 0.2
65 0.12
66 0.13
67 0.12
68 0.11
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.05
81 0.04
82 0.05
83 0.08
84 0.09
85 0.08
86 0.09
87 0.09
88 0.09
89 0.15
90 0.2
91 0.2
92 0.22
93 0.26
94 0.29
95 0.3
96 0.34
97 0.3
98 0.29
99 0.27
100 0.27
101 0.25
102 0.24
103 0.22
104 0.19
105 0.2
106 0.16
107 0.16
108 0.16
109 0.15
110 0.15
111 0.2
112 0.26
113 0.29
114 0.3
115 0.29
116 0.28
117 0.27
118 0.26
119 0.2
120 0.13
121 0.09
122 0.08
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.08
132 0.09
133 0.11
134 0.17
135 0.19
136 0.2
137 0.21
138 0.24
139 0.31
140 0.34
141 0.39
142 0.4
143 0.46
144 0.55
145 0.54
146 0.57
147 0.54
148 0.52
149 0.49
150 0.5
151 0.52
152 0.44
153 0.46
154 0.48
155 0.45
156 0.49
157 0.49
158 0.41
159 0.33
160 0.32
161 0.3
162 0.25
163 0.21
164 0.16
165 0.11
166 0.11
167 0.12
168 0.16
169 0.22
170 0.3
171 0.36
172 0.4
173 0.49
174 0.6
175 0.69
176 0.75
177 0.8
178 0.82
179 0.87
180 0.95
181 0.96
182 0.96
183 0.96
184 0.95