Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HPU1

Protein Details
Accession A0A1X2HPU1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
16-36MWCVLLHTKERKKRGHPRLVLHydrophilic
NLS Segment(s)
PositionSequence
27-28KK
96-101KLKRKK
Subcellular Location(s) mito 13, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MHKTIDQKAVVFYLGMWCVLLHTKERKKRGHPRLVLILASGTCHRSACYASDFSSKNISWIAFDWIAPHSSTEKKESSRSYDHPAYNLYHVGRNGKLKRKKDANG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.09
5 0.1
6 0.13
7 0.14
8 0.15
9 0.25
10 0.34
11 0.42
12 0.51
13 0.57
14 0.65
15 0.75
16 0.8
17 0.81
18 0.77
19 0.76
20 0.76
21 0.7
22 0.59
23 0.48
24 0.39
25 0.28
26 0.23
27 0.18
28 0.1
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.12
36 0.12
37 0.13
38 0.18
39 0.19
40 0.19
41 0.22
42 0.2
43 0.18
44 0.18
45 0.17
46 0.13
47 0.13
48 0.16
49 0.12
50 0.12
51 0.12
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.15
58 0.17
59 0.2
60 0.24
61 0.25
62 0.31
63 0.34
64 0.38
65 0.41
66 0.43
67 0.47
68 0.51
69 0.49
70 0.45
71 0.44
72 0.4
73 0.36
74 0.36
75 0.29
76 0.26
77 0.27
78 0.29
79 0.31
80 0.38
81 0.44
82 0.5
83 0.58
84 0.6
85 0.69