Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CXJ9

Protein Details
Accession J0CXJ9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-99FSSFFYKKLNQKKCVRARPQCYGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0008234  F:cysteine-type peptidase activity  
GO:0019783  F:ubiquitin-like protein peptidase activity  
GO:0006508  P:proteolysis  
KEGG adl:AURDEDRAFT_75247  -  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MCERALRPLRLTVLTFRRILVFPRGGPGALNISLGDLRRLTPGEFLNDTIIEFGLKYWLSYLRGMNPEVADSIHVFSSFFYKKLNQKKCVRARPQCYGGANAVIVALKRATRVYASGRTRWISSRRSTLLYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.35
4 0.34
5 0.32
6 0.33
7 0.33
8 0.29
9 0.26
10 0.29
11 0.29
12 0.26
13 0.25
14 0.23
15 0.19
16 0.15
17 0.15
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.09
24 0.1
25 0.11
26 0.12
27 0.12
28 0.14
29 0.15
30 0.18
31 0.18
32 0.18
33 0.17
34 0.16
35 0.16
36 0.13
37 0.11
38 0.07
39 0.06
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.1
47 0.12
48 0.13
49 0.15
50 0.17
51 0.18
52 0.18
53 0.16
54 0.14
55 0.13
56 0.12
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.11
65 0.11
66 0.11
67 0.12
68 0.17
69 0.25
70 0.36
71 0.45
72 0.48
73 0.56
74 0.66
75 0.75
76 0.8
77 0.83
78 0.82
79 0.81
80 0.8
81 0.77
82 0.72
83 0.63
84 0.56
85 0.47
86 0.38
87 0.3
88 0.22
89 0.17
90 0.12
91 0.1
92 0.08
93 0.08
94 0.07
95 0.09
96 0.09
97 0.1
98 0.11
99 0.15
100 0.2
101 0.29
102 0.34
103 0.37
104 0.42
105 0.43
106 0.44
107 0.47
108 0.48
109 0.46
110 0.47
111 0.52
112 0.51