Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0CUZ6

Protein Details
Accession J0CUZ6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-51KEATAPASRRRRRRSTKDIKTHFPEBasic
NLS Segment(s)
PositionSequence
34-41SRRRRRRS
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
KEGG adl:AURDEDRAFT_176740  -  
Amino Acid Sequences MALCGANPEAIVGLHLNTERPPYSPDKEATAPASRRRRRRSTKDIKTHFPENAEVLVYVEAARLFEKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.13
6 0.12
7 0.13
8 0.17
9 0.21
10 0.24
11 0.28
12 0.28
13 0.29
14 0.3
15 0.31
16 0.3
17 0.31
18 0.31
19 0.35
20 0.44
21 0.46
22 0.54
23 0.61
24 0.68
25 0.72
26 0.78
27 0.81
28 0.82
29 0.86
30 0.88
31 0.86
32 0.84
33 0.79
34 0.74
35 0.65
36 0.56
37 0.47
38 0.38
39 0.32
40 0.25
41 0.19
42 0.15
43 0.13
44 0.11
45 0.09
46 0.08
47 0.07
48 0.07
49 0.08