Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HIN2

Protein Details
Accession A0A1X2HIN2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-123QLTSILRKRRLKMNKHKHKKLRKRTRALRKKLGKBasic
NLS Segment(s)
PositionSequence
96-123RKRRLKMNKHKHKKLRKRTRALRKKLGK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFARAGAVFQRTCPVALAAKRSASSLVSHSTPLPTFLIPKQIPEVRNPLTEHMARLQPFKAPAAPVTPAAPITLAPLTAPSTPFPVEGFQLTSILRKRRLKMNKHKHKKLRKRTRALRKKLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.23
4 0.28
5 0.28
6 0.29
7 0.29
8 0.28
9 0.27
10 0.22
11 0.21
12 0.18
13 0.18
14 0.17
15 0.18
16 0.18
17 0.19
18 0.18
19 0.18
20 0.17
21 0.14
22 0.15
23 0.15
24 0.24
25 0.21
26 0.23
27 0.26
28 0.29
29 0.3
30 0.3
31 0.36
32 0.29
33 0.33
34 0.32
35 0.29
36 0.29
37 0.28
38 0.26
39 0.22
40 0.23
41 0.2
42 0.21
43 0.19
44 0.17
45 0.17
46 0.17
47 0.15
48 0.12
49 0.12
50 0.12
51 0.12
52 0.11
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.07
59 0.08
60 0.07
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.1
67 0.09
68 0.11
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.12
75 0.13
76 0.11
77 0.12
78 0.12
79 0.16
80 0.21
81 0.25
82 0.33
83 0.38
84 0.41
85 0.5
86 0.6
87 0.66
88 0.72
89 0.78
90 0.81
91 0.86
92 0.93
93 0.93
94 0.95
95 0.95
96 0.95
97 0.95
98 0.95
99 0.95
100 0.95
101 0.96
102 0.96
103 0.95