Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H1H2

Protein Details
Accession A0A1X2H1H2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-105LRKSLHKVPKFTKKTQRTSPEGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTLVAQGGLLWKNPFRMSATRKANVRKRLREVDQVIATLADSGVQCKALDQAKALPKEAEMHPRDKYTVFSGTSRGLRKSLHKVPKFTKKTQRTSPEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.18
5 0.21
6 0.21
7 0.2
8 0.2
9 0.28
10 0.32
11 0.4
12 0.46
13 0.48
14 0.54
15 0.62
16 0.66
17 0.68
18 0.71
19 0.7
20 0.7
21 0.73
22 0.72
23 0.71
24 0.66
25 0.63
26 0.54
27 0.45
28 0.37
29 0.29
30 0.24
31 0.15
32 0.11
33 0.06
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.09
41 0.1
42 0.1
43 0.1
44 0.16
45 0.21
46 0.23
47 0.24
48 0.2
49 0.19
50 0.23
51 0.24
52 0.27
53 0.24
54 0.27
55 0.28
56 0.29
57 0.3
58 0.27
59 0.27
60 0.22
61 0.24
62 0.22
63 0.21
64 0.22
65 0.25
66 0.3
67 0.31
68 0.29
69 0.27
70 0.28
71 0.34
72 0.41
73 0.47
74 0.52
75 0.55
76 0.61
77 0.69
78 0.77
79 0.78
80 0.78
81 0.79
82 0.78
83 0.82
84 0.84
85 0.84