Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HPC4

Protein Details
Accession A0A1X2HPC4   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSDSPTQKHKQQSQPRDARIISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 8, cyto 3.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003162  TFIID-31  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF02291  TFIID-31kDa  
CDD cd07979  TAF9  
Amino Acid Sequences MPSDSPTQKHKQQSQPRDARIISLILQSLGVEQFDPKVVPQLLEFAHRYTTDVIQDALVYAEHANKNDLDLDDIQLAIQGRVNHSFTNPPPKELLLELAEEKNKIPLPLIPEKYGIRLPADKHCLTGLNFSILPDAPPPPRPLGDTTGTPSATDTRNDPMDISPKSEHQAAAKLSSFPLASQQSAGTVQSVDDTTGSQKRGRDAMEDDDYDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.83
4 0.81
5 0.71
6 0.63
7 0.55
8 0.46
9 0.36
10 0.29
11 0.24
12 0.17
13 0.17
14 0.14
15 0.13
16 0.11
17 0.1
18 0.07
19 0.07
20 0.08
21 0.09
22 0.1
23 0.08
24 0.14
25 0.15
26 0.15
27 0.15
28 0.18
29 0.17
30 0.22
31 0.23
32 0.17
33 0.19
34 0.18
35 0.2
36 0.18
37 0.2
38 0.17
39 0.16
40 0.16
41 0.13
42 0.13
43 0.12
44 0.09
45 0.07
46 0.06
47 0.06
48 0.1
49 0.11
50 0.12
51 0.13
52 0.13
53 0.14
54 0.15
55 0.14
56 0.12
57 0.12
58 0.13
59 0.12
60 0.11
61 0.1
62 0.1
63 0.1
64 0.08
65 0.09
66 0.09
67 0.1
68 0.13
69 0.15
70 0.13
71 0.14
72 0.18
73 0.18
74 0.29
75 0.27
76 0.26
77 0.26
78 0.26
79 0.26
80 0.22
81 0.23
82 0.12
83 0.13
84 0.13
85 0.13
86 0.14
87 0.13
88 0.12
89 0.12
90 0.12
91 0.11
92 0.1
93 0.1
94 0.15
95 0.22
96 0.24
97 0.23
98 0.25
99 0.25
100 0.27
101 0.26
102 0.21
103 0.16
104 0.17
105 0.18
106 0.22
107 0.28
108 0.26
109 0.26
110 0.25
111 0.26
112 0.23
113 0.25
114 0.19
115 0.15
116 0.15
117 0.14
118 0.15
119 0.13
120 0.12
121 0.1
122 0.12
123 0.12
124 0.14
125 0.17
126 0.18
127 0.18
128 0.2
129 0.22
130 0.24
131 0.25
132 0.24
133 0.25
134 0.27
135 0.26
136 0.24
137 0.21
138 0.2
139 0.19
140 0.18
141 0.17
142 0.17
143 0.19
144 0.19
145 0.19
146 0.19
147 0.24
148 0.24
149 0.27
150 0.24
151 0.24
152 0.27
153 0.28
154 0.26
155 0.21
156 0.27
157 0.23
158 0.26
159 0.26
160 0.24
161 0.22
162 0.23
163 0.21
164 0.15
165 0.21
166 0.19
167 0.18
168 0.18
169 0.18
170 0.18
171 0.19
172 0.19
173 0.13
174 0.1
175 0.1
176 0.11
177 0.11
178 0.1
179 0.09
180 0.1
181 0.14
182 0.19
183 0.21
184 0.23
185 0.25
186 0.29
187 0.33
188 0.34
189 0.34
190 0.33
191 0.38
192 0.41