Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HW73

Protein Details
Accession A0A1X2HW73    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGANKKNNNNNNNKARRKHDVQHydrophilic
92-114VWACNRRECMRKPTRYIRYTPKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGANKKNNNNNNNKARRKHDVQPVLLGVPDGRVEHDTDAYVTKLGGVPIWLQPDTPPSKSVCTCKNCGQLQYLIFQGYVPLPESIYHRVIYVWACNRRECMRKPTRYIRYTPKTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.77
5 0.75
6 0.75
7 0.73
8 0.66
9 0.64
10 0.58
11 0.49
12 0.43
13 0.34
14 0.23
15 0.15
16 0.14
17 0.09
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.08
29 0.07
30 0.08
31 0.07
32 0.07
33 0.06
34 0.07
35 0.09
36 0.11
37 0.11
38 0.1
39 0.1
40 0.16
41 0.18
42 0.18
43 0.17
44 0.16
45 0.19
46 0.22
47 0.26
48 0.28
49 0.29
50 0.33
51 0.37
52 0.44
53 0.43
54 0.43
55 0.41
56 0.36
57 0.33
58 0.3
59 0.25
60 0.17
61 0.16
62 0.13
63 0.12
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.09
70 0.13
71 0.16
72 0.18
73 0.17
74 0.16
75 0.16
76 0.17
77 0.18
78 0.21
79 0.26
80 0.32
81 0.34
82 0.35
83 0.4
84 0.45
85 0.52
86 0.51
87 0.53
88 0.56
89 0.63
90 0.71
91 0.77
92 0.8
93 0.78
94 0.8
95 0.8