Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HVR5

Protein Details
Accession A0A1X2HVR5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-76SAPPVPRRLPKNLQHKPKRLHydrophilic
NLS Segment(s)
PositionSequence
63-75RRLPKNLQHKPKR
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MVNSTRGHCPRCNAQLHSFQINVRSYFVMCSDLKCPYPFDEPDAAPFLSNQRANRMSAPPVPRRLPKNLQHKPKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.59
4 0.57
5 0.5
6 0.42
7 0.42
8 0.39
9 0.34
10 0.26
11 0.22
12 0.19
13 0.18
14 0.18
15 0.16
16 0.13
17 0.14
18 0.15
19 0.16
20 0.17
21 0.17
22 0.18
23 0.16
24 0.2
25 0.19
26 0.21
27 0.22
28 0.21
29 0.22
30 0.23
31 0.21
32 0.16
33 0.16
34 0.15
35 0.17
36 0.2
37 0.19
38 0.23
39 0.24
40 0.26
41 0.3
42 0.31
43 0.29
44 0.33
45 0.4
46 0.4
47 0.46
48 0.5
49 0.53
50 0.56
51 0.6
52 0.63
53 0.64
54 0.69
55 0.72
56 0.77