Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HTZ8

Protein Details
Accession A0A1X2HTZ8    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-49HSLPKLNRRKRSTSRSRCCRYAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9, nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDSRSAMVCGRGIFCLRGRDAAFILYHSLPKLNRRKRSTSRSRCCRYAVAVFLDLAYAIKNRPPLSRKTNVFPLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.24
4 0.23
5 0.26
6 0.25
7 0.25
8 0.24
9 0.23
10 0.2
11 0.16
12 0.18
13 0.14
14 0.14
15 0.12
16 0.14
17 0.14
18 0.22
19 0.32
20 0.38
21 0.47
22 0.52
23 0.61
24 0.67
25 0.76
26 0.79
27 0.79
28 0.81
29 0.83
30 0.83
31 0.77
32 0.71
33 0.63
34 0.56
35 0.5
36 0.42
37 0.35
38 0.3
39 0.26
40 0.23
41 0.2
42 0.15
43 0.11
44 0.08
45 0.06
46 0.06
47 0.08
48 0.13
49 0.15
50 0.23
51 0.27
52 0.35
53 0.43
54 0.52
55 0.55
56 0.57
57 0.65