Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HTW8

Protein Details
Accession A0A1X2HTW8   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-119KTGSSRREHLNDRKDRRNRRQQQENQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MSFKAAKRILPTQIYFHASRPIPSLSHARSVFRSLGQFGEMAEYRFMRCPETQKYLQYGFVIYRNKEDAEQALKTKFLQVSSGFDVPCDVALDKTGSSRREHLNDRKDRRNRRQQQENQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.39
4 0.39
5 0.33
6 0.33
7 0.31
8 0.28
9 0.24
10 0.26
11 0.32
12 0.26
13 0.34
14 0.34
15 0.33
16 0.33
17 0.36
18 0.34
19 0.28
20 0.27
21 0.2
22 0.2
23 0.18
24 0.16
25 0.12
26 0.14
27 0.13
28 0.12
29 0.12
30 0.11
31 0.12
32 0.15
33 0.15
34 0.14
35 0.15
36 0.2
37 0.24
38 0.3
39 0.32
40 0.31
41 0.35
42 0.33
43 0.33
44 0.27
45 0.23
46 0.17
47 0.2
48 0.21
49 0.17
50 0.18
51 0.18
52 0.18
53 0.18
54 0.17
55 0.15
56 0.16
57 0.17
58 0.17
59 0.16
60 0.17
61 0.16
62 0.19
63 0.18
64 0.14
65 0.16
66 0.15
67 0.19
68 0.23
69 0.25
70 0.21
71 0.2
72 0.2
73 0.17
74 0.16
75 0.13
76 0.09
77 0.07
78 0.09
79 0.1
80 0.1
81 0.14
82 0.18
83 0.19
84 0.22
85 0.27
86 0.32
87 0.38
88 0.47
89 0.52
90 0.58
91 0.67
92 0.72
93 0.78
94 0.82
95 0.86
96 0.88
97 0.89
98 0.9
99 0.9