Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HTR8

Protein Details
Accession A0A1X2HTR8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-65IGLKKKLESHEKKKKLPRRHDRTNNQHHDABasic
NLS Segment(s)
PositionSequence
39-55KKKLESHEKKKKLPRRH
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MLPRSKIWYILYLLLTARSASFLLETLREIKTCVPIGLKKKLESHEKKKKLPRRHDRTNNQHHDAMHLPRKYNLHESCMCVKRPCFCTFSAQTSGGLSFISLVHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.16
4 0.13
5 0.1
6 0.09
7 0.08
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.12
14 0.13
15 0.13
16 0.13
17 0.14
18 0.17
19 0.17
20 0.17
21 0.18
22 0.22
23 0.28
24 0.36
25 0.37
26 0.35
27 0.39
28 0.44
29 0.51
30 0.54
31 0.59
32 0.62
33 0.67
34 0.72
35 0.77
36 0.81
37 0.8
38 0.82
39 0.83
40 0.81
41 0.85
42 0.87
43 0.88
44 0.89
45 0.9
46 0.87
47 0.8
48 0.73
49 0.62
50 0.55
51 0.48
52 0.44
53 0.41
54 0.35
55 0.32
56 0.33
57 0.35
58 0.35
59 0.4
60 0.36
61 0.35
62 0.35
63 0.39
64 0.45
65 0.47
66 0.47
67 0.42
68 0.42
69 0.43
70 0.45
71 0.44
72 0.38
73 0.35
74 0.41
75 0.41
76 0.45
77 0.43
78 0.39
79 0.35
80 0.34
81 0.33
82 0.24
83 0.19
84 0.13
85 0.09