Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H551

Protein Details
Accession A0A1X2H551   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-130GMAEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGBasic
NLS Segment(s)
PositionSequence
99-132AEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGKK
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASTVTIRTRKFLTNRLLQRKQMVVDVLHPGTATISRENIREKLAKMYKTEKDFISVFGFKTQFGGGKTTGFGLIYDSVESLKKFEPKYRLVRLGMAEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.62
5 0.69
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.3
16 0.25
17 0.21
18 0.2
19 0.16
20 0.14
21 0.15
22 0.14
23 0.1
24 0.13
25 0.14
26 0.17
27 0.2
28 0.21
29 0.23
30 0.24
31 0.24
32 0.31
33 0.35
34 0.35
35 0.36
36 0.41
37 0.43
38 0.44
39 0.46
40 0.36
41 0.34
42 0.32
43 0.3
44 0.27
45 0.23
46 0.19
47 0.2
48 0.2
49 0.16
50 0.17
51 0.15
52 0.12
53 0.12
54 0.14
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.11
72 0.16
73 0.17
74 0.23
75 0.29
76 0.35
77 0.43
78 0.49
79 0.52
80 0.48
81 0.5
82 0.46
83 0.44
84 0.42
85 0.37
86 0.31
87 0.25
88 0.27
89 0.29
90 0.32
91 0.37
92 0.42
93 0.49
94 0.6
95 0.7
96 0.78
97 0.84
98 0.91
99 0.93
100 0.94
101 0.94
102 0.94
103 0.94
104 0.93
105 0.93
106 0.92
107 0.91
108 0.87
109 0.86
110 0.83
111 0.81
112 0.73