Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CSZ6

Protein Details
Accession J0CSZ6   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
223-251PSSPKTYRASWVKKRSAEKNKSTERRSQRHydrophilic
NLS Segment(s)
PositionSequence
108-129KRTALPSRAPKKESGGKRRRGK
235-248KKRSAEKNKSTERR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_131692  -  
Amino Acid Sequences MSEDPVPFVGSFKLTTKNPVFLWHGLSRSGKEEHPPRSALSDDHYSTPGSGLSANPSKDDKGNDSPFEADIAASSSSKPRVRFSSDASDEECDEAPVDSLEPTPIRVKRTALPSRAPKKESGGKRRRGKPDDSMKWQNWQCRIIAGRQIMFYWLDGVKSLRRPPADVPIGEDDNVFVYNSPGRPHHKAWVTRNGDWMEADLKDDFRANQLFAADGEKLVLTIPSSPKTYRASWVKKRSAEKNKSTERRSQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.31
3 0.33
4 0.36
5 0.35
6 0.39
7 0.41
8 0.36
9 0.42
10 0.37
11 0.35
12 0.35
13 0.37
14 0.33
15 0.32
16 0.33
17 0.28
18 0.33
19 0.4
20 0.42
21 0.44
22 0.44
23 0.41
24 0.42
25 0.41
26 0.34
27 0.31
28 0.31
29 0.28
30 0.28
31 0.28
32 0.25
33 0.23
34 0.23
35 0.18
36 0.11
37 0.1
38 0.09
39 0.14
40 0.18
41 0.19
42 0.2
43 0.22
44 0.23
45 0.25
46 0.28
47 0.28
48 0.32
49 0.37
50 0.36
51 0.36
52 0.35
53 0.32
54 0.3
55 0.24
56 0.14
57 0.09
58 0.1
59 0.09
60 0.08
61 0.09
62 0.1
63 0.16
64 0.2
65 0.21
66 0.24
67 0.28
68 0.34
69 0.36
70 0.39
71 0.44
72 0.43
73 0.43
74 0.41
75 0.37
76 0.31
77 0.3
78 0.24
79 0.14
80 0.11
81 0.09
82 0.08
83 0.06
84 0.06
85 0.05
86 0.05
87 0.07
88 0.06
89 0.08
90 0.13
91 0.15
92 0.18
93 0.19
94 0.21
95 0.24
96 0.34
97 0.39
98 0.37
99 0.42
100 0.49
101 0.56
102 0.59
103 0.56
104 0.48
105 0.47
106 0.51
107 0.53
108 0.55
109 0.56
110 0.6
111 0.68
112 0.75
113 0.79
114 0.76
115 0.71
116 0.69
117 0.71
118 0.68
119 0.67
120 0.66
121 0.57
122 0.61
123 0.59
124 0.55
125 0.48
126 0.42
127 0.34
128 0.3
129 0.3
130 0.25
131 0.27
132 0.24
133 0.21
134 0.21
135 0.2
136 0.18
137 0.17
138 0.14
139 0.11
140 0.09
141 0.08
142 0.08
143 0.1
144 0.12
145 0.16
146 0.2
147 0.22
148 0.23
149 0.25
150 0.27
151 0.34
152 0.35
153 0.31
154 0.32
155 0.32
156 0.32
157 0.3
158 0.27
159 0.18
160 0.15
161 0.15
162 0.11
163 0.06
164 0.07
165 0.09
166 0.11
167 0.13
168 0.17
169 0.22
170 0.28
171 0.3
172 0.37
173 0.42
174 0.49
175 0.54
176 0.6
177 0.61
178 0.57
179 0.61
180 0.54
181 0.47
182 0.39
183 0.34
184 0.26
185 0.19
186 0.19
187 0.13
188 0.13
189 0.13
190 0.14
191 0.13
192 0.15
193 0.16
194 0.15
195 0.16
196 0.15
197 0.15
198 0.14
199 0.17
200 0.12
201 0.11
202 0.11
203 0.09
204 0.09
205 0.08
206 0.08
207 0.06
208 0.11
209 0.15
210 0.18
211 0.21
212 0.22
213 0.27
214 0.32
215 0.34
216 0.38
217 0.45
218 0.52
219 0.59
220 0.69
221 0.73
222 0.76
223 0.82
224 0.84
225 0.85
226 0.85
227 0.84
228 0.84
229 0.86
230 0.88
231 0.85