Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H2E0

Protein Details
Accession A0A1X2H2E0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-72GECTTRKGKKSWKGKKTRKEKKRKKEGEIEANNRERBasic
NLS Segment(s)
PositionSequence
42-62RKGKKSWKGKKTRKEKKRKKE
Subcellular Location(s) E.R. 8, extr 7, mito 4, plas 2, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MSLYVRVCVCVCFCLCLCGDIRCSNEQKKSDRDKETGECTTRKGKKSWKGKKTRKEKKRKKEGEIEANNRERGVYVCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.18
5 0.17
6 0.2
7 0.21
8 0.24
9 0.26
10 0.31
11 0.35
12 0.4
13 0.43
14 0.45
15 0.5
16 0.57
17 0.61
18 0.6
19 0.57
20 0.55
21 0.54
22 0.54
23 0.49
24 0.42
25 0.35
26 0.32
27 0.39
28 0.39
29 0.38
30 0.38
31 0.43
32 0.49
33 0.59
34 0.67
35 0.68
36 0.74
37 0.81
38 0.86
39 0.89
40 0.91
41 0.91
42 0.92
43 0.92
44 0.92
45 0.94
46 0.94
47 0.91
48 0.91
49 0.9
50 0.89
51 0.88
52 0.85
53 0.83
54 0.79
55 0.7
56 0.6
57 0.5
58 0.4