Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HTH7

Protein Details
Accession A0A1X2HTH7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-103EGAKSDEQKKKKKYGKKKRSLKGPNKWKNRRWBasic
NLS Segment(s)
PositionSequence
79-103QKKKKKYGKKKRSLKGPNKWKNRRW
Subcellular Location(s) nucl 14, mito 11.5, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MGRSVRSHAVKRNRAVKRDAVFQPIEDARLARLAKAQAEASQKPKVIEKMKDEEEKKENEAKAEEDTAMDVEGAKSDEQKKKKKYGKKKRSLKGPNKWKNRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.69
4 0.63
5 0.63
6 0.58
7 0.54
8 0.47
9 0.42
10 0.42
11 0.34
12 0.31
13 0.22
14 0.19
15 0.14
16 0.19
17 0.18
18 0.13
19 0.16
20 0.16
21 0.16
22 0.18
23 0.18
24 0.17
25 0.22
26 0.24
27 0.25
28 0.28
29 0.28
30 0.27
31 0.29
32 0.31
33 0.31
34 0.34
35 0.34
36 0.36
37 0.4
38 0.46
39 0.44
40 0.43
41 0.4
42 0.38
43 0.36
44 0.36
45 0.32
46 0.27
47 0.27
48 0.23
49 0.21
50 0.2
51 0.17
52 0.12
53 0.12
54 0.1
55 0.09
56 0.07
57 0.06
58 0.05
59 0.05
60 0.06
61 0.06
62 0.1
63 0.18
64 0.26
65 0.34
66 0.44
67 0.51
68 0.6
69 0.69
70 0.76
71 0.8
72 0.84
73 0.87
74 0.88
75 0.92
76 0.91
77 0.93
78 0.93
79 0.93
80 0.92
81 0.92
82 0.92
83 0.93