Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HKQ9

Protein Details
Accession A0A1X2HKQ9    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTPRKRPPPRKRKLKTSLKDLLATHydrophilic
307-346KARIGAIERKKDRQREKLLTKKKKNKRVKKDEDEDDNDDEBasic
NLS Segment(s)
PositionSequence
4-33RKRPPPRKRKLKTSLKDLLATAEREKKRAK
305-336REKARIGAIERKKDRQREKLLTKKKKNKRVKK
Subcellular Location(s) nucl 11.5, mito 9.5, cyto_nucl 9.333, cyto_mito 8.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019446  BMT5-like  
Gene Ontology GO:0070042  F:rRNA (uridine-N3-)-methyltransferase activity  
GO:0070475  P:rRNA base methylation  
Pfam View protein in Pfam  
PF10354  BMT5-like  
Amino Acid Sequences MTPRKRPPPRKRKLKTSLKDLLATAEREKKRAKIEAQKEAAIEQHKQIHAPVKPDYVAIDRILLVGEGNFSFARSLAENYFDGDASRIVATSFDKPEVMREKYSEEGTENVEAFKSMDGTVLFGIDATRLNKYKKLKGHYFTKIIFNFPHHGLGIKDQDHNVRANQLLLKNFWAAAKPLLAEEGRKYRIPRKEKKEDEQVEEDEEEEEEEGPEIEEETLAEGEIHVTVKTCAPYHLWDVKKLAKTTGDFAIKTTLAFHPSFYPGYEHRRTLGFKTGVSKGGNEEILASQPKTFIIVRKEAMAEEREKARIGAIERKKDRQREKLLTKKKKNKRVKKDEDEDDNDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.89
5 0.82
6 0.76
7 0.65
8 0.6
9 0.53
10 0.47
11 0.43
12 0.43
13 0.4
14 0.42
15 0.45
16 0.45
17 0.48
18 0.54
19 0.57
20 0.58
21 0.66
22 0.71
23 0.71
24 0.68
25 0.61
26 0.53
27 0.49
28 0.42
29 0.35
30 0.29
31 0.31
32 0.3
33 0.3
34 0.32
35 0.35
36 0.35
37 0.37
38 0.36
39 0.33
40 0.33
41 0.32
42 0.32
43 0.27
44 0.26
45 0.22
46 0.2
47 0.16
48 0.15
49 0.15
50 0.12
51 0.09
52 0.07
53 0.07
54 0.06
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.1
61 0.09
62 0.12
63 0.11
64 0.14
65 0.14
66 0.16
67 0.16
68 0.15
69 0.14
70 0.12
71 0.11
72 0.09
73 0.09
74 0.07
75 0.07
76 0.08
77 0.1
78 0.13
79 0.15
80 0.15
81 0.15
82 0.15
83 0.22
84 0.28
85 0.29
86 0.27
87 0.27
88 0.29
89 0.31
90 0.32
91 0.27
92 0.21
93 0.19
94 0.19
95 0.2
96 0.16
97 0.14
98 0.13
99 0.12
100 0.11
101 0.09
102 0.08
103 0.06
104 0.08
105 0.07
106 0.08
107 0.08
108 0.08
109 0.07
110 0.06
111 0.06
112 0.05
113 0.07
114 0.07
115 0.11
116 0.14
117 0.16
118 0.21
119 0.27
120 0.33
121 0.38
122 0.45
123 0.5
124 0.53
125 0.6
126 0.61
127 0.62
128 0.57
129 0.58
130 0.5
131 0.44
132 0.39
133 0.33
134 0.3
135 0.26
136 0.25
137 0.17
138 0.17
139 0.15
140 0.18
141 0.19
142 0.18
143 0.18
144 0.17
145 0.2
146 0.2
147 0.21
148 0.18
149 0.15
150 0.14
151 0.14
152 0.16
153 0.16
154 0.16
155 0.15
156 0.16
157 0.14
158 0.14
159 0.13
160 0.11
161 0.09
162 0.09
163 0.08
164 0.07
165 0.07
166 0.08
167 0.08
168 0.08
169 0.1
170 0.15
171 0.17
172 0.19
173 0.21
174 0.27
175 0.36
176 0.45
177 0.52
178 0.56
179 0.65
180 0.7
181 0.74
182 0.78
183 0.74
184 0.69
185 0.64
186 0.55
187 0.46
188 0.39
189 0.33
190 0.22
191 0.17
192 0.12
193 0.08
194 0.07
195 0.05
196 0.05
197 0.04
198 0.04
199 0.04
200 0.05
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.04
213 0.05
214 0.06
215 0.08
216 0.09
217 0.1
218 0.1
219 0.12
220 0.14
221 0.2
222 0.28
223 0.28
224 0.29
225 0.33
226 0.38
227 0.42
228 0.4
229 0.36
230 0.32
231 0.32
232 0.33
233 0.35
234 0.33
235 0.27
236 0.28
237 0.29
238 0.24
239 0.23
240 0.23
241 0.17
242 0.18
243 0.18
244 0.18
245 0.17
246 0.19
247 0.2
248 0.18
249 0.2
250 0.21
251 0.29
252 0.32
253 0.31
254 0.3
255 0.34
256 0.36
257 0.35
258 0.4
259 0.34
260 0.31
261 0.35
262 0.37
263 0.37
264 0.35
265 0.33
266 0.26
267 0.28
268 0.26
269 0.21
270 0.19
271 0.15
272 0.18
273 0.2
274 0.18
275 0.14
276 0.15
277 0.15
278 0.16
279 0.17
280 0.2
281 0.23
282 0.28
283 0.29
284 0.31
285 0.32
286 0.3
287 0.32
288 0.3
289 0.27
290 0.26
291 0.28
292 0.27
293 0.27
294 0.26
295 0.24
296 0.24
297 0.25
298 0.31
299 0.37
300 0.46
301 0.51
302 0.6
303 0.67
304 0.73
305 0.78
306 0.79
307 0.81
308 0.81
309 0.86
310 0.88
311 0.9
312 0.92
313 0.93
314 0.94
315 0.94
316 0.94
317 0.94
318 0.94
319 0.95
320 0.95
321 0.95
322 0.95
323 0.94
324 0.93
325 0.91
326 0.87