Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HUE2

Protein Details
Accession A0A1X2HUE2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-30KHTIVKKRTAHFKRHQSDRFHRVGBasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPAVKHTIVKKRTAHFKRHQSDRFHRVGESWRKPKGIDSCVRRRFRGQAPMPKIGYGSNKKTRHMLPNGFQKFTVKNVADLNMLLMHNRTFAAEIAHNVSAKKRVELLERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.71
4 0.71
5 0.78
6 0.79
7 0.83
8 0.83
9 0.81
10 0.84
11 0.81
12 0.77
13 0.67
14 0.58
15 0.51
16 0.53
17 0.54
18 0.54
19 0.53
20 0.52
21 0.51
22 0.51
23 0.55
24 0.53
25 0.51
26 0.49
27 0.5
28 0.57
29 0.65
30 0.68
31 0.64
32 0.59
33 0.58
34 0.57
35 0.59
36 0.56
37 0.57
38 0.59
39 0.63
40 0.59
41 0.53
42 0.46
43 0.38
44 0.37
45 0.33
46 0.35
47 0.38
48 0.4
49 0.41
50 0.45
51 0.46
52 0.46
53 0.47
54 0.45
55 0.41
56 0.5
57 0.52
58 0.48
59 0.45
60 0.39
61 0.33
62 0.31
63 0.31
64 0.21
65 0.2
66 0.21
67 0.22
68 0.2
69 0.19
70 0.17
71 0.12
72 0.12
73 0.1
74 0.1
75 0.08
76 0.08
77 0.09
78 0.08
79 0.07
80 0.07
81 0.1
82 0.1
83 0.11
84 0.14
85 0.16
86 0.16
87 0.16
88 0.18
89 0.21
90 0.21
91 0.21
92 0.21
93 0.23
94 0.28
95 0.33
96 0.37
97 0.38
98 0.4
99 0.4
100 0.37
101 0.35
102 0.3
103 0.29
104 0.24
105 0.16
106 0.14
107 0.13
108 0.15
109 0.16
110 0.18
111 0.16