Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HU77

Protein Details
Accession A0A1X2HU77    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-52VAKQEKKKAKTGRAKKRQVYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
16-43RAGKVKSQTPKVAKQEKKKAKTGRAKKR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPVSELNGKVHGSLARAGKVKSQTPKVAKQEKKKAKTGRAKKRQVYNRRFVNVTTSFGGKRRMNPAPTQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.25
5 0.28
6 0.31
7 0.35
8 0.38
9 0.41
10 0.44
11 0.48
12 0.56
13 0.6
14 0.66
15 0.67
16 0.7
17 0.75
18 0.77
19 0.76
20 0.77
21 0.75
22 0.75
23 0.78
24 0.78
25 0.78
26 0.79
27 0.83
28 0.81
29 0.83
30 0.84
31 0.84
32 0.83
33 0.81
34 0.79
35 0.73
36 0.68
37 0.58
38 0.56
39 0.47
40 0.42
41 0.35
42 0.29
43 0.27
44 0.29
45 0.37
46 0.32
47 0.35
48 0.39
49 0.45
50 0.47
51 0.51