Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GC71

Protein Details
Accession A0A1X2GC71   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
13-48PTPTTVKVKVGKKRGPRPGKREKKLKIKLTAKENSNHydrophilic
171-197GLTPPMKWARKRRFRKKLSKRAIEEVEHydrophilic
NLS Segment(s)
PositionSequence
20-40VKVGKKRGPRPGKREKKLKIK
177-191KWARKRRFRKKLSKR
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MDIDGNPGNIDHPTPTTVKVKVGKKRGPRPGKREKKLKIKLTAKENSNSMAVSEDEEEPEPTIEEHLILRLPEGQLCEKLHEYVKKREIPEDVKLNFKDNRRGYFSIDGERHEVTLVDLPTIIESQKTLDKKQFYKIADISQMLVVDGASMEPLAPQTQGRNHEPFMYPHGLTPPMKWARKRRFRKKLSKRAIEEVEKEVERLLEEDAAAENVIYDVVDCREEEMESDGGTQGLISDEDSESDAELEAAIDRDLEELDEEADDEDDDDEDDDEDEDSDDEDEETGQTGEIEQKQQEIIEIKQAIERKNRDLLTAPNAILKKRFEITIENLKKELTLKEAHLKELMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.26
4 0.27
5 0.33
6 0.39
7 0.46
8 0.52
9 0.6
10 0.64
11 0.7
12 0.78
13 0.82
14 0.85
15 0.87
16 0.88
17 0.89
18 0.92
19 0.91
20 0.92
21 0.9
22 0.9
23 0.9
24 0.89
25 0.89
26 0.86
27 0.84
28 0.83
29 0.82
30 0.76
31 0.7
32 0.63
33 0.54
34 0.46
35 0.39
36 0.29
37 0.22
38 0.17
39 0.14
40 0.15
41 0.13
42 0.14
43 0.15
44 0.15
45 0.14
46 0.14
47 0.13
48 0.11
49 0.11
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.1
57 0.12
58 0.12
59 0.13
60 0.16
61 0.16
62 0.2
63 0.21
64 0.24
65 0.22
66 0.24
67 0.28
68 0.32
69 0.36
70 0.41
71 0.48
72 0.51
73 0.51
74 0.53
75 0.55
76 0.52
77 0.54
78 0.53
79 0.47
80 0.48
81 0.47
82 0.47
83 0.45
84 0.45
85 0.47
86 0.43
87 0.47
88 0.47
89 0.48
90 0.47
91 0.49
92 0.47
93 0.45
94 0.42
95 0.38
96 0.34
97 0.32
98 0.28
99 0.21
100 0.19
101 0.12
102 0.15
103 0.13
104 0.1
105 0.1
106 0.1
107 0.1
108 0.11
109 0.1
110 0.05
111 0.05
112 0.07
113 0.12
114 0.15
115 0.17
116 0.22
117 0.28
118 0.3
119 0.36
120 0.41
121 0.37
122 0.41
123 0.4
124 0.38
125 0.35
126 0.33
127 0.28
128 0.22
129 0.21
130 0.14
131 0.12
132 0.09
133 0.05
134 0.05
135 0.04
136 0.03
137 0.02
138 0.02
139 0.03
140 0.03
141 0.04
142 0.04
143 0.05
144 0.07
145 0.12
146 0.16
147 0.2
148 0.22
149 0.23
150 0.25
151 0.26
152 0.25
153 0.26
154 0.25
155 0.21
156 0.19
157 0.2
158 0.2
159 0.19
160 0.18
161 0.22
162 0.26
163 0.29
164 0.34
165 0.43
166 0.51
167 0.61
168 0.72
169 0.74
170 0.78
171 0.85
172 0.91
173 0.92
174 0.93
175 0.93
176 0.91
177 0.84
178 0.8
179 0.76
180 0.69
181 0.6
182 0.52
183 0.45
184 0.35
185 0.31
186 0.24
187 0.18
188 0.14
189 0.12
190 0.09
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.04
199 0.03
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.08
211 0.1
212 0.09
213 0.09
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.04
220 0.04
221 0.05
222 0.04
223 0.06
224 0.06
225 0.07
226 0.08
227 0.07
228 0.07
229 0.07
230 0.07
231 0.05
232 0.05
233 0.05
234 0.04
235 0.05
236 0.04
237 0.04
238 0.04
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.06
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.07
262 0.06
263 0.06
264 0.06
265 0.07
266 0.06
267 0.06
268 0.06
269 0.06
270 0.07
271 0.06
272 0.06
273 0.06
274 0.06
275 0.11
276 0.14
277 0.17
278 0.16
279 0.17
280 0.18
281 0.18
282 0.21
283 0.19
284 0.17
285 0.22
286 0.22
287 0.22
288 0.25
289 0.3
290 0.32
291 0.38
292 0.42
293 0.39
294 0.46
295 0.46
296 0.45
297 0.44
298 0.44
299 0.41
300 0.41
301 0.37
302 0.35
303 0.36
304 0.36
305 0.37
306 0.34
307 0.32
308 0.3
309 0.31
310 0.27
311 0.32
312 0.37
313 0.44
314 0.48
315 0.46
316 0.45
317 0.43
318 0.42
319 0.39
320 0.34
321 0.28
322 0.25
323 0.28
324 0.37
325 0.39
326 0.4