Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GLB0

Protein Details
Accession A0A1X2GLB0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
126-148ANVLRNSGKKYCRSNRKKTKRNRHydrophilic
NLS Segment(s)
PositionSequence
139-148SNRKKTKRNR
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, pero 3
Family & Domain DBs
Amino Acid Sequences NEFQVSAVDPGRRVTVTAALGDDRNAPIRRVTSKEIQAQAGTKARSIKAEQRKAATMINMDQSPMSFKAWETALPTTRTASCDTYDNHVECLLQNMDNVLDMYGQEHSRDRFAAFRGRQRSHDFAANVLRNSGKKYCRSNRKKTKRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.19
5 0.19
6 0.18
7 0.18
8 0.18
9 0.18
10 0.14
11 0.2
12 0.2
13 0.2
14 0.21
15 0.25
16 0.29
17 0.32
18 0.36
19 0.37
20 0.42
21 0.48
22 0.48
23 0.46
24 0.42
25 0.39
26 0.38
27 0.36
28 0.29
29 0.24
30 0.25
31 0.24
32 0.26
33 0.28
34 0.33
35 0.38
36 0.46
37 0.47
38 0.46
39 0.48
40 0.46
41 0.44
42 0.36
43 0.27
44 0.2
45 0.2
46 0.17
47 0.15
48 0.13
49 0.12
50 0.13
51 0.12
52 0.11
53 0.08
54 0.08
55 0.1
56 0.1
57 0.11
58 0.11
59 0.13
60 0.15
61 0.16
62 0.17
63 0.16
64 0.17
65 0.17
66 0.17
67 0.16
68 0.14
69 0.16
70 0.17
71 0.2
72 0.23
73 0.22
74 0.2
75 0.19
76 0.18
77 0.15
78 0.17
79 0.14
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.09
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.09
93 0.11
94 0.12
95 0.14
96 0.15
97 0.15
98 0.16
99 0.19
100 0.27
101 0.29
102 0.37
103 0.44
104 0.47
105 0.51
106 0.55
107 0.58
108 0.52
109 0.54
110 0.46
111 0.41
112 0.47
113 0.46
114 0.39
115 0.36
116 0.35
117 0.3
118 0.35
119 0.38
120 0.35
121 0.38
122 0.48
123 0.57
124 0.65
125 0.75
126 0.81
127 0.85
128 0.9