Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G9K8

Protein Details
Accession A0A1X2G9K8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-36LATPSPPAKRNRAKKIKFTPLETHydrophilic
NLS Segment(s)
PositionSequence
19-29PPAKRNRAKKI
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
CDD cd11660  SANT_TRF  
Amino Acid Sequences MVEGNLPPTERGRLATPSPPAKRNRAKKIKFTPLETQSLEDGMREFGTSWSEILKKYEDIFAPNQRTNVDLKDKARTEVKKRKTYNMSLGGFAAVDPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.37
4 0.43
5 0.47
6 0.51
7 0.53
8 0.58
9 0.65
10 0.69
11 0.73
12 0.75
13 0.76
14 0.8
15 0.85
16 0.86
17 0.8
18 0.76
19 0.73
20 0.67
21 0.65
22 0.55
23 0.47
24 0.36
25 0.32
26 0.26
27 0.18
28 0.13
29 0.09
30 0.08
31 0.06
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.08
38 0.09
39 0.09
40 0.1
41 0.11
42 0.11
43 0.12
44 0.15
45 0.14
46 0.16
47 0.2
48 0.26
49 0.3
50 0.31
51 0.31
52 0.28
53 0.29
54 0.28
55 0.28
56 0.28
57 0.28
58 0.29
59 0.36
60 0.37
61 0.39
62 0.45
63 0.48
64 0.51
65 0.57
66 0.64
67 0.66
68 0.69
69 0.76
70 0.76
71 0.77
72 0.76
73 0.75
74 0.67
75 0.58
76 0.55
77 0.45
78 0.36