Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GM42

Protein Details
Accession A0A1X2GM42    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-50NYSFTLRRKTPDYKRTRRSRTFMLCTNHydrophilic
NLS Segment(s)
PositionSequence
190-199AEKKNKKGNR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006015  Universal_stress_UspA  
IPR006016  UspA  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MAVSNSKESRVVSFDTMSNVDLPNYSFTLRRKTPDYKRTRRSRTFMLCTNLESYSDHALQWTISQIMDDGDELVVVRVLNVELSDKRNVVQAQLQYEAKQAKDRAMEVIDRVLTSAGPDIKFSVVIEFVIGKVHETIQQMIAVYQPSMLIVGTRGLSEFKGMFIGSVSKYCLQHVPIPVVVVRPEGAKQAEKKNKKGNRLSAMMRRGKDLDGASISSSTSTPASTALPHPHHLLPVPAFPNVSATCLCSIAPPPPPPPPPANPPAKNRLVLRIDSPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.25
5 0.23
6 0.2
7 0.17
8 0.16
9 0.16
10 0.15
11 0.15
12 0.16
13 0.19
14 0.22
15 0.31
16 0.33
17 0.37
18 0.42
19 0.5
20 0.59
21 0.66
22 0.73
23 0.75
24 0.81
25 0.87
26 0.9
27 0.9
28 0.86
29 0.86
30 0.84
31 0.81
32 0.78
33 0.73
34 0.64
35 0.56
36 0.52
37 0.42
38 0.33
39 0.27
40 0.22
41 0.21
42 0.2
43 0.18
44 0.16
45 0.15
46 0.14
47 0.14
48 0.13
49 0.09
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.08
69 0.09
70 0.12
71 0.14
72 0.14
73 0.15
74 0.19
75 0.19
76 0.19
77 0.21
78 0.21
79 0.21
80 0.25
81 0.25
82 0.21
83 0.24
84 0.25
85 0.21
86 0.23
87 0.21
88 0.21
89 0.22
90 0.22
91 0.21
92 0.21
93 0.21
94 0.16
95 0.17
96 0.14
97 0.12
98 0.12
99 0.09
100 0.07
101 0.07
102 0.09
103 0.09
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.1
110 0.08
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.06
117 0.05
118 0.05
119 0.05
120 0.06
121 0.09
122 0.1
123 0.11
124 0.1
125 0.11
126 0.11
127 0.1
128 0.11
129 0.07
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.03
137 0.03
138 0.04
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.07
146 0.06
147 0.07
148 0.06
149 0.06
150 0.06
151 0.08
152 0.07
153 0.08
154 0.1
155 0.12
156 0.13
157 0.14
158 0.16
159 0.16
160 0.2
161 0.21
162 0.22
163 0.19
164 0.2
165 0.19
166 0.18
167 0.16
168 0.12
169 0.11
170 0.09
171 0.09
172 0.11
173 0.13
174 0.16
175 0.2
176 0.3
177 0.4
178 0.46
179 0.53
180 0.6
181 0.65
182 0.7
183 0.74
184 0.73
185 0.7
186 0.69
187 0.68
188 0.66
189 0.69
190 0.66
191 0.57
192 0.51
193 0.46
194 0.41
195 0.38
196 0.31
197 0.25
198 0.2
199 0.21
200 0.18
201 0.17
202 0.16
203 0.13
204 0.12
205 0.1
206 0.09
207 0.08
208 0.07
209 0.08
210 0.09
211 0.11
212 0.15
213 0.22
214 0.24
215 0.27
216 0.3
217 0.3
218 0.31
219 0.29
220 0.3
221 0.24
222 0.27
223 0.27
224 0.24
225 0.24
226 0.22
227 0.26
228 0.22
229 0.22
230 0.16
231 0.16
232 0.17
233 0.17
234 0.17
235 0.14
236 0.16
237 0.18
238 0.25
239 0.27
240 0.3
241 0.37
242 0.41
243 0.44
244 0.49
245 0.5
246 0.51
247 0.56
248 0.62
249 0.61
250 0.66
251 0.69
252 0.69
253 0.68
254 0.63
255 0.63
256 0.58
257 0.53
258 0.52