Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GIK3

Protein Details
Accession A0A1X2GIK3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-58KPTYRCEWLNCRRNKKPFTKRHKICNHLRSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MWRGCGQYHTGIRNLTDHIIEAHIGSGKPTYRCEWLNCRRNKKPFTKRHKICNHLRSHTGERPFVCAQPGCDKRFSRPDSLTTHIKTHSTVRPFVCSYEGCEKAYYHARSLKKHLRLHEITQTSSPMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.21
4 0.18
5 0.16
6 0.15
7 0.14
8 0.12
9 0.11
10 0.11
11 0.11
12 0.1
13 0.12
14 0.15
15 0.16
16 0.19
17 0.21
18 0.23
19 0.26
20 0.31
21 0.39
22 0.46
23 0.54
24 0.6
25 0.67
26 0.71
27 0.77
28 0.81
29 0.81
30 0.82
31 0.83
32 0.84
33 0.86
34 0.84
35 0.85
36 0.86
37 0.83
38 0.82
39 0.81
40 0.78
41 0.7
42 0.67
43 0.62
44 0.6
45 0.57
46 0.5
47 0.44
48 0.37
49 0.39
50 0.36
51 0.31
52 0.26
53 0.2
54 0.19
55 0.25
56 0.3
57 0.26
58 0.31
59 0.32
60 0.35
61 0.43
62 0.45
63 0.42
64 0.39
65 0.42
66 0.41
67 0.45
68 0.46
69 0.39
70 0.39
71 0.34
72 0.32
73 0.29
74 0.3
75 0.31
76 0.29
77 0.32
78 0.31
79 0.35
80 0.35
81 0.34
82 0.32
83 0.26
84 0.28
85 0.31
86 0.32
87 0.28
88 0.28
89 0.27
90 0.29
91 0.37
92 0.34
93 0.31
94 0.36
95 0.4
96 0.44
97 0.54
98 0.59
99 0.59
100 0.63
101 0.64
102 0.67
103 0.67
104 0.68
105 0.68
106 0.62
107 0.56
108 0.52