Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GHQ9

Protein Details
Accession A0A1X2GHQ9   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
171-194AALRAKNKAMRQRQAEKKASKAHAHydrophilic
NLS Segment(s)
PositionSequence
63-122RKPEIGASRERYRERLAAKRLGRHMGHGKRKGTANARMSRQTLWMRRMRVLRRLLRKYRE
173-193LRAKNKAMRQRQAEKKASKAH
Subcellular Location(s) mito 17, nucl 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR023638  Ribosomal_L19/L19e_CS  
IPR015972  Ribosomal_L19/L19e_dom1  
IPR033935  Ribosomal_L19_euka  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
PROSITE View protein in PROSITE  
PS00526  RIBOSOMAL_L19E  
CDD cd01417  Ribosomal_L19e_E  
Amino Acid Sequences MGLVTISINFSTVNLSIQKRLASKVLGCGQRKIWLDPNEVTEISNANSRANIRKLVKDGLIIRKPEIGASRERYRERLAAKRLGRHMGHGKRKGTANARMSRQTLWMRRMRVLRRLLRKYREAGKIDKHLYHNLYLKSKGNGFKNKRVLMEYIHKAKAEQIRAKNIAEQAAALRAKNKAMRQRQAEKKASKAHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.24
5 0.28
6 0.27
7 0.29
8 0.3
9 0.28
10 0.27
11 0.32
12 0.38
13 0.42
14 0.42
15 0.43
16 0.41
17 0.45
18 0.46
19 0.42
20 0.44
21 0.41
22 0.44
23 0.42
24 0.44
25 0.41
26 0.38
27 0.34
28 0.26
29 0.22
30 0.18
31 0.2
32 0.16
33 0.13
34 0.15
35 0.17
36 0.22
37 0.24
38 0.3
39 0.29
40 0.33
41 0.36
42 0.37
43 0.35
44 0.34
45 0.37
46 0.39
47 0.41
48 0.38
49 0.35
50 0.34
51 0.33
52 0.31
53 0.28
54 0.21
55 0.22
56 0.27
57 0.33
58 0.36
59 0.38
60 0.39
61 0.38
62 0.41
63 0.4
64 0.42
65 0.41
66 0.44
67 0.45
68 0.48
69 0.48
70 0.49
71 0.44
72 0.41
73 0.45
74 0.46
75 0.52
76 0.52
77 0.5
78 0.47
79 0.49
80 0.49
81 0.45
82 0.44
83 0.43
84 0.42
85 0.44
86 0.44
87 0.43
88 0.38
89 0.38
90 0.37
91 0.34
92 0.35
93 0.37
94 0.36
95 0.4
96 0.46
97 0.45
98 0.46
99 0.5
100 0.51
101 0.57
102 0.64
103 0.67
104 0.65
105 0.66
106 0.63
107 0.63
108 0.63
109 0.57
110 0.53
111 0.51
112 0.53
113 0.53
114 0.52
115 0.47
116 0.43
117 0.42
118 0.41
119 0.41
120 0.37
121 0.37
122 0.36
123 0.35
124 0.33
125 0.36
126 0.37
127 0.4
128 0.46
129 0.49
130 0.56
131 0.62
132 0.63
133 0.6
134 0.57
135 0.5
136 0.46
137 0.48
138 0.46
139 0.44
140 0.43
141 0.4
142 0.38
143 0.42
144 0.43
145 0.43
146 0.44
147 0.44
148 0.5
149 0.53
150 0.54
151 0.52
152 0.47
153 0.41
154 0.33
155 0.27
156 0.2
157 0.24
158 0.24
159 0.2
160 0.2
161 0.2
162 0.25
163 0.3
164 0.36
165 0.4
166 0.49
167 0.58
168 0.64
169 0.73
170 0.79
171 0.83
172 0.85
173 0.81
174 0.8