Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G8V3

Protein Details
Accession A0A1X2G8V3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-156LNVTRRVVENQGKKRKKKGAEENHydrophilic
NLS Segment(s)
PositionSequence
145-152GKKRKKKG
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007364  SFM1-like  
Gene Ontology GO:0008168  F:methyltransferase activity  
Pfam View protein in Pfam  
PF04252  RNA_Me_trans  
CDD cd18090  Arginine_MT_Sfm1  
Amino Acid Sequences MSKKHYIIEHMEDGMHDWCLLEYKHMLSNVGPDHLWFSCLSEKCLETMPEELKQAHCHSNDVMNLPGVDPSKVCLLDPSAEKELSPEDAETFDYFLFGGILGDDPPRDRTGELRKLGFAGRRLGPVQMTTDTALNVTRRVVENQGKKRKKKGAEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.12
4 0.09
5 0.09
6 0.11
7 0.11
8 0.12
9 0.12
10 0.14
11 0.18
12 0.18
13 0.19
14 0.16
15 0.22
16 0.21
17 0.21
18 0.19
19 0.15
20 0.18
21 0.17
22 0.18
23 0.12
24 0.13
25 0.19
26 0.2
27 0.22
28 0.21
29 0.21
30 0.21
31 0.24
32 0.22
33 0.16
34 0.19
35 0.2
36 0.19
37 0.2
38 0.2
39 0.19
40 0.22
41 0.23
42 0.24
43 0.22
44 0.22
45 0.22
46 0.24
47 0.24
48 0.22
49 0.2
50 0.15
51 0.14
52 0.13
53 0.14
54 0.11
55 0.09
56 0.08
57 0.08
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.11
64 0.12
65 0.15
66 0.15
67 0.15
68 0.15
69 0.15
70 0.14
71 0.13
72 0.13
73 0.09
74 0.07
75 0.08
76 0.09
77 0.09
78 0.09
79 0.07
80 0.07
81 0.06
82 0.06
83 0.05
84 0.04
85 0.04
86 0.03
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.08
93 0.09
94 0.1
95 0.1
96 0.16
97 0.26
98 0.34
99 0.36
100 0.36
101 0.35
102 0.36
103 0.39
104 0.37
105 0.3
106 0.27
107 0.25
108 0.27
109 0.28
110 0.28
111 0.25
112 0.23
113 0.23
114 0.19
115 0.19
116 0.16
117 0.16
118 0.15
119 0.15
120 0.17
121 0.14
122 0.14
123 0.13
124 0.15
125 0.17
126 0.2
127 0.27
128 0.34
129 0.43
130 0.53
131 0.63
132 0.7
133 0.75
134 0.82
135 0.84
136 0.84