Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GEW6

Protein Details
Accession A0A1X2GEW6    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
22-41SDDKPSKRSGRRKIKIEYIEBasic
113-133PASAETRPSSKRRRRSVTTKLHydrophilic
NLS Segment(s)
PositionSequence
26-55PSKRSGRRKIKIEYIEDKNRRHITFSKRKA
123-126KRRR
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences MMNTPPAPSKNKPFDEDSGDDSDDKPSKRSGRRKIKIEYIEDKNRRHITFSKRKAGIMKKAYELSTLTGTQVLLLVVSETGLVYTFTTVKLQPIVTKPEGKNLIQACLNAPDPASAETRPSSKRRRRSVTTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.54
4 0.49
5 0.43
6 0.39
7 0.35
8 0.31
9 0.32
10 0.29
11 0.27
12 0.25
13 0.27
14 0.35
15 0.44
16 0.53
17 0.59
18 0.65
19 0.73
20 0.79
21 0.79
22 0.8
23 0.77
24 0.75
25 0.72
26 0.69
27 0.7
28 0.69
29 0.64
30 0.63
31 0.62
32 0.55
33 0.51
34 0.5
35 0.5
36 0.55
37 0.6
38 0.61
39 0.56
40 0.58
41 0.61
42 0.6
43 0.59
44 0.54
45 0.49
46 0.42
47 0.43
48 0.42
49 0.35
50 0.29
51 0.21
52 0.17
53 0.15
54 0.12
55 0.1
56 0.1
57 0.08
58 0.08
59 0.06
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.06
74 0.07
75 0.08
76 0.09
77 0.1
78 0.11
79 0.14
80 0.17
81 0.23
82 0.25
83 0.33
84 0.32
85 0.39
86 0.42
87 0.39
88 0.42
89 0.37
90 0.37
91 0.31
92 0.31
93 0.24
94 0.24
95 0.25
96 0.18
97 0.17
98 0.14
99 0.15
100 0.16
101 0.17
102 0.14
103 0.16
104 0.18
105 0.23
106 0.29
107 0.35
108 0.45
109 0.52
110 0.62
111 0.69
112 0.76
113 0.81