Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GE03

Protein Details
Accession A0A1X2GE03    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
154-176TDDVNKITRRRCKQIIKNYEQEMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 4, cysk 3, cyto_pero 3, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010301  RRP1  
Gene Ontology GO:0005634  C:nucleus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05997  Nop52  
Amino Acid Sequences MGLFYCFWMSDKPLVQQQLANELGSLQLLLQDDNVIPFVSMFWKIHCAEWYGLDRIRTDKYLLLFRRQIFYSFAWLATHQWDQEKIEAYTTCLLQGPLHPTDRSKPDGIKFHILDIYLDELNKVIEQQQEGMDDDDELAVPMGQLLRPIHVLCTDDVNKITRRRCKQIIKNYEQEMEQEDEEDEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.33
4 0.31
5 0.33
6 0.31
7 0.27
8 0.21
9 0.18
10 0.17
11 0.14
12 0.13
13 0.05
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.1
22 0.07
23 0.07
24 0.07
25 0.07
26 0.08
27 0.1
28 0.1
29 0.11
30 0.15
31 0.16
32 0.19
33 0.19
34 0.21
35 0.19
36 0.23
37 0.25
38 0.24
39 0.24
40 0.24
41 0.23
42 0.23
43 0.24
44 0.21
45 0.19
46 0.18
47 0.19
48 0.27
49 0.28
50 0.31
51 0.34
52 0.34
53 0.36
54 0.34
55 0.33
56 0.28
57 0.26
58 0.26
59 0.21
60 0.2
61 0.17
62 0.17
63 0.16
64 0.16
65 0.16
66 0.12
67 0.12
68 0.13
69 0.13
70 0.15
71 0.17
72 0.14
73 0.15
74 0.14
75 0.14
76 0.14
77 0.13
78 0.12
79 0.1
80 0.1
81 0.08
82 0.1
83 0.12
84 0.13
85 0.15
86 0.15
87 0.16
88 0.19
89 0.23
90 0.25
91 0.23
92 0.24
93 0.27
94 0.33
95 0.36
96 0.38
97 0.35
98 0.33
99 0.32
100 0.29
101 0.24
102 0.18
103 0.17
104 0.11
105 0.11
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.11
116 0.12
117 0.13
118 0.14
119 0.12
120 0.1
121 0.1
122 0.08
123 0.07
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.08
132 0.08
133 0.1
134 0.12
135 0.12
136 0.13
137 0.14
138 0.16
139 0.13
140 0.2
141 0.21
142 0.21
143 0.23
144 0.26
145 0.3
146 0.36
147 0.43
148 0.46
149 0.52
150 0.59
151 0.67
152 0.74
153 0.78
154 0.82
155 0.85
156 0.83
157 0.84
158 0.8
159 0.73
160 0.63
161 0.54
162 0.47
163 0.4
164 0.32
165 0.24
166 0.2
167 0.17