Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GT87

Protein Details
Accession A0A1X2GT87    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-101NSLAPIVKPPPRRRRSRQTPISQPPTAPHydrophilic
NLS Segment(s)
PositionSequence
83-89PPRRRRS
Subcellular Location(s) mito_nucl 13.833, mito 13.5, nucl 13, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGPPRRLVQSVTSPTSLLRPASKGSHYLGGELGPMASPLAMPVDYPNEGHSPPGSDTADLTKRDLVPDTHDAHNSLAPIVKPPPRRRRSRQTPISQPPTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.25
5 0.2
6 0.19
7 0.21
8 0.25
9 0.26
10 0.25
11 0.25
12 0.3
13 0.27
14 0.26
15 0.23
16 0.19
17 0.17
18 0.15
19 0.12
20 0.05
21 0.05
22 0.04
23 0.04
24 0.03
25 0.03
26 0.04
27 0.04
28 0.04
29 0.05
30 0.07
31 0.08
32 0.08
33 0.1
34 0.1
35 0.11
36 0.11
37 0.1
38 0.1
39 0.1
40 0.14
41 0.12
42 0.11
43 0.11
44 0.16
45 0.2
46 0.19
47 0.19
48 0.18
49 0.18
50 0.19
51 0.2
52 0.17
53 0.18
54 0.22
55 0.25
56 0.25
57 0.25
58 0.26
59 0.25
60 0.25
61 0.2
62 0.16
63 0.14
64 0.12
65 0.14
66 0.18
67 0.24
68 0.32
69 0.42
70 0.53
71 0.6
72 0.7
73 0.77
74 0.83
75 0.88
76 0.89
77 0.9
78 0.89
79 0.91
80 0.92
81 0.9