Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G7Q0

Protein Details
Accession A0A1X2G7Q0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-70TECLANPAKKTKKQNTINYHLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MKLKQLKVRPKKIIESSQCLTEMGALFECWATSGVDDKRCITTARSLTECLANPAKKTKKQNTINYHLARLSKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.65
4 0.59
5 0.53
6 0.44
7 0.35
8 0.27
9 0.21
10 0.14
11 0.12
12 0.09
13 0.08
14 0.08
15 0.08
16 0.06
17 0.06
18 0.05
19 0.05
20 0.1
21 0.12
22 0.15
23 0.16
24 0.16
25 0.17
26 0.18
27 0.19
28 0.16
29 0.2
30 0.21
31 0.24
32 0.24
33 0.24
34 0.24
35 0.27
36 0.26
37 0.24
38 0.27
39 0.25
40 0.25
41 0.34
42 0.4
43 0.44
44 0.54
45 0.6
46 0.63
47 0.72
48 0.81
49 0.8
50 0.81
51 0.84
52 0.77
53 0.71
54 0.64
55 0.56