Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GZI9

Protein Details
Accession A0A1X2GZI9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30ADTSKKATWKPFGRRINNLKKRRNPLPSPHydrophilic
NLS Segment(s)
PositionSequence
12-25PFGRRINNLKKRRN
Subcellular Location(s) nucl 14, mito_nucl 12.666, cyto_nucl 10.166, mito 9
Family & Domain DBs
Amino Acid Sequences MADTSKKATWKPFGRRINNLKKRRNPLPSPGRLFASTIILDNSNDLKNTLPIRLCLFNSLYFLFYAPVLGYSQDPWGGSKPALALPSWQSTIRQARATFPAAVPIFSGDIVLYALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.84
4 0.85
5 0.86
6 0.86
7 0.87
8 0.86
9 0.87
10 0.86
11 0.85
12 0.79
13 0.79
14 0.8
15 0.79
16 0.76
17 0.7
18 0.63
19 0.54
20 0.49
21 0.39
22 0.32
23 0.23
24 0.17
25 0.15
26 0.13
27 0.12
28 0.12
29 0.14
30 0.11
31 0.11
32 0.1
33 0.1
34 0.13
35 0.14
36 0.15
37 0.14
38 0.14
39 0.17
40 0.19
41 0.18
42 0.17
43 0.17
44 0.15
45 0.16
46 0.15
47 0.13
48 0.11
49 0.11
50 0.09
51 0.07
52 0.07
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.08
62 0.09
63 0.1
64 0.11
65 0.11
66 0.11
67 0.12
68 0.13
69 0.14
70 0.13
71 0.13
72 0.15
73 0.19
74 0.2
75 0.19
76 0.18
77 0.24
78 0.32
79 0.33
80 0.35
81 0.33
82 0.35
83 0.39
84 0.42
85 0.37
86 0.29
87 0.34
88 0.28
89 0.28
90 0.24
91 0.21
92 0.18
93 0.16
94 0.16
95 0.08
96 0.08