Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GDV6

Protein Details
Accession A0A1X2GDV6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-75LGKIQQIKKEQEKKQQLEKQKKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015033  HBS1-like_N  
Pfam View protein in Pfam  
PF08938  HBS1_N  
Amino Acid Sequences DESQLSNEDLEQLDEGLQYVYSVLGDDVPLTDVEIKEALWYYYFDKEETVDWALGKIQQIKKEQEKKQQLEKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.07
28 0.08
29 0.12
30 0.12
31 0.12
32 0.12
33 0.13
34 0.13
35 0.15
36 0.15
37 0.12
38 0.11
39 0.11
40 0.12
41 0.13
42 0.15
43 0.2
44 0.22
45 0.27
46 0.33
47 0.41
48 0.51
49 0.59
50 0.64
51 0.67
52 0.75
53 0.76
54 0.81
55 0.82