Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GAA0

Protein Details
Accession A0A1X2GAA0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-61QIERNERTLRHQKRRPDQKQPSRLHPDDBasic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 1, plas 1, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRPFVPSFLFLGPLLTFLYACLLAKKQEGSIHCQIERNERTLRHQKRRPDQKQPSRLHPDDHCPPGKRHQFEGFMGCDKVETALAQGELYYGRLRINAKPVDAFVTYDALDSDVFVCNARNRNRALGGDLVAIQHPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.1
4 0.08
5 0.1
6 0.09
7 0.09
8 0.1
9 0.11
10 0.13
11 0.15
12 0.16
13 0.16
14 0.2
15 0.22
16 0.28
17 0.33
18 0.37
19 0.36
20 0.39
21 0.38
22 0.44
23 0.44
24 0.4
25 0.38
26 0.35
27 0.42
28 0.48
29 0.57
30 0.58
31 0.62
32 0.67
33 0.73
34 0.83
35 0.83
36 0.84
37 0.85
38 0.85
39 0.89
40 0.84
41 0.82
42 0.8
43 0.73
44 0.66
45 0.57
46 0.54
47 0.49
48 0.5
49 0.45
50 0.38
51 0.39
52 0.44
53 0.49
54 0.45
55 0.42
56 0.41
57 0.4
58 0.38
59 0.4
60 0.32
61 0.26
62 0.24
63 0.2
64 0.15
65 0.12
66 0.11
67 0.08
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.07
77 0.06
78 0.06
79 0.06
80 0.09
81 0.12
82 0.14
83 0.22
84 0.23
85 0.24
86 0.24
87 0.25
88 0.25
89 0.24
90 0.22
91 0.15
92 0.15
93 0.14
94 0.13
95 0.12
96 0.1
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.11
104 0.15
105 0.23
106 0.29
107 0.33
108 0.35
109 0.4
110 0.44
111 0.43
112 0.42
113 0.37
114 0.32
115 0.29
116 0.27
117 0.23