Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GM89

Protein Details
Accession A0A1X2GM89    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-44QLGFKSARPPSRQKRKKKISTCFFAVHydrophilic
NLS Segment(s)
PositionSequence
25-36ARPPSRQKRKKK
Subcellular Location(s) plas 15, nucl 8, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKNETWCENHADGWTSPSQLGFKSARPPSRQKRKKKISTCFFAVVCLSVSCFKEGWSFCFFIGSLVLSWQHLKTPISPHIPTLIHPTQAMGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.19
4 0.19
5 0.18
6 0.14
7 0.19
8 0.17
9 0.18
10 0.26
11 0.32
12 0.37
13 0.42
14 0.52
15 0.58
16 0.68
17 0.75
18 0.77
19 0.82
20 0.86
21 0.91
22 0.91
23 0.9
24 0.88
25 0.85
26 0.78
27 0.71
28 0.6
29 0.5
30 0.4
31 0.3
32 0.21
33 0.14
34 0.1
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.14
41 0.15
42 0.18
43 0.18
44 0.19
45 0.18
46 0.19
47 0.18
48 0.13
49 0.14
50 0.1
51 0.07
52 0.07
53 0.08
54 0.08
55 0.1
56 0.09
57 0.11
58 0.13
59 0.14
60 0.17
61 0.23
62 0.29
63 0.34
64 0.35
65 0.34
66 0.38
67 0.37
68 0.35
69 0.38
70 0.34
71 0.29
72 0.28
73 0.29