Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CUE8

Protein Details
Accession J0CUE8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
192-218ACRVWTRRPGAGPRRVRRKRGGGQEASHydrophilic
NLS Segment(s)
PositionSequence
198-212RRPGAGPRRVRRKRG
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, extr 4, mito 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_117787  -  
Amino Acid Sequences PHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPDPSQPLPSSQVLQAEVEDYVQHCFSWAAPPIWLTPAGRVAEQGSGSVLLSFSREEDLEYVLRNGVFLFGRALRVRRFRDSGRPRPCSNCCSLEHSARACSQAPRCGLCSGGHLTSEHHCGECDFFDDAHEGLAHCGHTALCCPHCAGSHAMCDSACRVWTRRPGAGPRRVRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.09
10 0.09
11 0.1
12 0.11
13 0.11
14 0.12
15 0.15
16 0.17
17 0.16
18 0.15
19 0.19
20 0.22
21 0.23
22 0.23
23 0.2
24 0.21
25 0.23
26 0.23
27 0.21
28 0.18
29 0.2
30 0.24
31 0.25
32 0.24
33 0.23
34 0.25
35 0.23
36 0.22
37 0.18
38 0.15
39 0.13
40 0.11
41 0.1
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.12
50 0.15
51 0.14
52 0.14
53 0.16
54 0.16
55 0.17
56 0.18
57 0.13
58 0.12
59 0.16
60 0.16
61 0.15
62 0.15
63 0.14
64 0.15
65 0.14
66 0.13
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.04
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.09
81 0.08
82 0.09
83 0.09
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.1
94 0.11
95 0.13
96 0.16
97 0.23
98 0.26
99 0.28
100 0.31
101 0.31
102 0.41
103 0.49
104 0.55
105 0.58
106 0.6
107 0.58
108 0.62
109 0.63
110 0.56
111 0.51
112 0.45
113 0.38
114 0.4
115 0.41
116 0.37
117 0.37
118 0.34
119 0.32
120 0.28
121 0.28
122 0.23
123 0.24
124 0.24
125 0.25
126 0.26
127 0.26
128 0.27
129 0.25
130 0.25
131 0.21
132 0.21
133 0.19
134 0.17
135 0.17
136 0.15
137 0.16
138 0.17
139 0.2
140 0.17
141 0.15
142 0.14
143 0.14
144 0.15
145 0.13
146 0.14
147 0.12
148 0.11
149 0.11
150 0.13
151 0.12
152 0.11
153 0.11
154 0.08
155 0.08
156 0.09
157 0.08
158 0.07
159 0.07
160 0.07
161 0.07
162 0.1
163 0.14
164 0.14
165 0.15
166 0.16
167 0.17
168 0.18
169 0.2
170 0.21
171 0.2
172 0.24
173 0.23
174 0.24
175 0.22
176 0.22
177 0.22
178 0.19
179 0.19
180 0.17
181 0.2
182 0.26
183 0.35
184 0.4
185 0.43
186 0.49
187 0.57
188 0.64
189 0.71
190 0.74
191 0.75
192 0.81
193 0.84
194 0.85
195 0.84
196 0.85
197 0.85
198 0.85
199 0.85
200 0.8
201 0.74
202 0.72
203 0.63