Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GMF5

Protein Details
Accession A0A1X2GMF5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77HPPVRPQLKTRRKERPPAASBasic
NLS Segment(s)
PositionSequence
65-83LKTRRKERPPAASGSRLRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MTHDYSPHAAAPPVCRSPKNAINNMAVLSSSPTIKKAVHQQSYQKKQQDILYASPIHHPPVRPQLKTRRKERPPAASGSRLRKTPPTANPLSPTTSAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.38
4 0.43
5 0.49
6 0.53
7 0.52
8 0.5
9 0.5
10 0.5
11 0.45
12 0.37
13 0.29
14 0.2
15 0.16
16 0.12
17 0.1
18 0.1
19 0.1
20 0.12
21 0.12
22 0.15
23 0.23
24 0.31
25 0.35
26 0.39
27 0.47
28 0.55
29 0.63
30 0.67
31 0.61
32 0.53
33 0.5
34 0.5
35 0.47
36 0.4
37 0.34
38 0.31
39 0.27
40 0.27
41 0.27
42 0.25
43 0.2
44 0.19
45 0.18
46 0.19
47 0.29
48 0.35
49 0.33
50 0.4
51 0.49
52 0.57
53 0.65
54 0.69
55 0.69
56 0.71
57 0.79
58 0.8
59 0.8
60 0.74
61 0.73
62 0.7
63 0.68
64 0.68
65 0.67
66 0.63
67 0.54
68 0.53
69 0.52
70 0.53
71 0.53
72 0.54
73 0.54
74 0.55
75 0.58
76 0.6
77 0.56
78 0.54