Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GZG3

Protein Details
Accession A0A1X2GZG3   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
97-122NDSIKKAMGSHRKNRKPKKTACCGGHHydrophilic
NLS Segment(s)
PositionSequence
103-115AMGSHRKNRKPKK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MATPSKQAAISAYRNLLKTQKQVFGNDLAAVEAARKETYARFMQNKNEANTDVLEEKLALANQVATLLRRNVVQAESADGGELYKLHITKDTELGDNDSIKKAMGSHRKNRKPKKTACCGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.38
4 0.37
5 0.41
6 0.43
7 0.44
8 0.44
9 0.45
10 0.45
11 0.42
12 0.38
13 0.31
14 0.25
15 0.18
16 0.15
17 0.13
18 0.11
19 0.07
20 0.07
21 0.06
22 0.07
23 0.08
24 0.09
25 0.14
26 0.17
27 0.22
28 0.27
29 0.3
30 0.36
31 0.43
32 0.47
33 0.44
34 0.42
35 0.37
36 0.33
37 0.3
38 0.25
39 0.18
40 0.13
41 0.11
42 0.08
43 0.08
44 0.07
45 0.07
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.09
62 0.11
63 0.11
64 0.11
65 0.11
66 0.09
67 0.08
68 0.07
69 0.07
70 0.05
71 0.07
72 0.07
73 0.08
74 0.12
75 0.14
76 0.16
77 0.21
78 0.22
79 0.22
80 0.23
81 0.26
82 0.24
83 0.24
84 0.24
85 0.2
86 0.18
87 0.16
88 0.16
89 0.15
90 0.22
91 0.3
92 0.38
93 0.46
94 0.58
95 0.68
96 0.79
97 0.87
98 0.89
99 0.89
100 0.91
101 0.91
102 0.91