Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GG64

Protein Details
Accession A0A1X2GG64    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-68VPRPTTSAKRCQRQRSCFLWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0019104  F:DNA N-glycosylase activity  
Amino Acid Sequences MLDDHFFATKRNTFYTCFNASFLVPNSNFTNKDDDITFNNHNIGFNNIVPRPTTSAKRCQRQRSCFLWTCFHNKRRHHMAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.4
4 0.36
5 0.33
6 0.3
7 0.28
8 0.29
9 0.25
10 0.25
11 0.2
12 0.21
13 0.24
14 0.26
15 0.26
16 0.24
17 0.28
18 0.22
19 0.23
20 0.21
21 0.2
22 0.19
23 0.23
24 0.23
25 0.17
26 0.18
27 0.17
28 0.17
29 0.15
30 0.15
31 0.12
32 0.11
33 0.15
34 0.14
35 0.14
36 0.15
37 0.16
38 0.19
39 0.2
40 0.27
41 0.28
42 0.38
43 0.46
44 0.55
45 0.63
46 0.69
47 0.76
48 0.77
49 0.8
50 0.76
51 0.77
52 0.75
53 0.7
54 0.66
55 0.6
56 0.61
57 0.63
58 0.65
59 0.65
60 0.64
61 0.69