Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GFS4

Protein Details
Accession A0A1X2GFS4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LPPWPMYRRHQLKWKQIKAQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 3, E.R. 3, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MAIIDYLQWTIDYKGQRLNEYLTHILLVITSVAAFAAGYMTESMRMILAVFAFGFIVTSVVVLPPWPMYRRHQLKWKQIKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.28
4 0.28
5 0.3
6 0.27
7 0.3
8 0.3
9 0.24
10 0.21
11 0.19
12 0.17
13 0.13
14 0.11
15 0.05
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.11
53 0.12
54 0.16
55 0.22
56 0.33
57 0.41
58 0.48
59 0.56
60 0.62
61 0.72
62 0.8