Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GF01

Protein Details
Accession A0A1X2GF01    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKEKPHKRDKCPKAFKRKSDLSKHIEBasic
42-63ARTFKTKKTHYVHMKKACPNAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MKEKPHKRDKCPKAFKRKSDLSKHIEAIHTNTDRLPCPNECARTFKTKKTHYVHMKKACPNAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.88
4 0.87
5 0.85
6 0.84
7 0.82
8 0.77
9 0.72
10 0.66
11 0.59
12 0.51
13 0.42
14 0.35
15 0.33
16 0.27
17 0.22
18 0.21
19 0.2
20 0.19
21 0.2
22 0.2
23 0.14
24 0.19
25 0.24
26 0.28
27 0.28
28 0.34
29 0.36
30 0.43
31 0.46
32 0.49
33 0.53
34 0.55
35 0.63
36 0.63
37 0.7
38 0.7
39 0.77
40 0.8
41 0.8
42 0.82
43 0.79