Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GI03

Protein Details
Accession A0A1X2GI03   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-81LIDAREKKKQDKVDKKKQKLEDAKQRFIEKQREKKRESKKMKKEKIAKAIKSABasic
NLS Segment(s)
PositionSequence
33-87REKKKQDKVDKKKQKLEDAKQRFIEKQREKKRESKKMKKEKIAKAIKSATKKSVK
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MFAIIDQAADKISQKEEERLAKKMAVEELIDAREKKKQDKVDKKKQKLEDAKQRFIEKQREKKRESKKMKKEKIAKAIKSATKKSVKFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.3
4 0.38
5 0.4
6 0.41
7 0.41
8 0.38
9 0.37
10 0.35
11 0.3
12 0.22
13 0.19
14 0.17
15 0.16
16 0.16
17 0.17
18 0.15
19 0.14
20 0.17
21 0.19
22 0.22
23 0.27
24 0.35
25 0.44
26 0.55
27 0.65
28 0.72
29 0.8
30 0.84
31 0.84
32 0.81
33 0.8
34 0.78
35 0.77
36 0.76
37 0.74
38 0.72
39 0.68
40 0.65
41 0.6
42 0.57
43 0.58
44 0.57
45 0.6
46 0.64
47 0.69
48 0.72
49 0.77
50 0.81
51 0.81
52 0.83
53 0.83
54 0.84
55 0.87
56 0.92
57 0.92
58 0.92
59 0.9
60 0.9
61 0.89
62 0.81
63 0.78
64 0.77
65 0.75
66 0.73
67 0.68
68 0.67
69 0.66