Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GXW2

Protein Details
Accession A0A1X2GXW2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-29KHTIVKKRTAHFKRHQSDRFMRVBasic
NLS Segment(s)
PositionSequence
28-59RVGESWRKPKGIDSRVRRRFKGTAPMPKIGYG
61-62AK
Subcellular Location(s) mito 16.5, mito_nucl 11.333, cyto_nucl 5.833, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPAVKHTIVKKRTAHFKRHQSDRFMRVGESWRKPKGIDSRVRRRFKGTAPMPKIGYGSAKKTRHMLPNGFRKFSVSNLKDLEILLMHNRSYAAEIAHNVSSKNRIAILERAAQLNVKVINAQAKLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.71
4 0.71
5 0.78
6 0.79
7 0.83
8 0.81
9 0.8
10 0.8
11 0.76
12 0.71
13 0.61
14 0.53
15 0.45
16 0.48
17 0.48
18 0.48
19 0.48
20 0.46
21 0.46
22 0.46
23 0.5
24 0.51
25 0.52
26 0.53
27 0.56
28 0.64
29 0.73
30 0.78
31 0.72
32 0.68
33 0.64
34 0.59
35 0.59
36 0.56
37 0.57
38 0.56
39 0.58
40 0.53
41 0.49
42 0.44
43 0.34
44 0.31
45 0.23
46 0.24
47 0.29
48 0.3
49 0.3
50 0.33
51 0.37
52 0.39
53 0.42
54 0.42
55 0.41
56 0.5
57 0.53
58 0.5
59 0.45
60 0.41
61 0.37
62 0.36
63 0.38
64 0.29
65 0.3
66 0.3
67 0.31
68 0.29
69 0.28
70 0.23
71 0.13
72 0.12
73 0.11
74 0.1
75 0.09
76 0.09
77 0.1
78 0.09
79 0.1
80 0.1
81 0.09
82 0.09
83 0.11
84 0.13
85 0.15
86 0.15
87 0.14
88 0.15
89 0.18
90 0.18
91 0.18
92 0.17
93 0.16
94 0.19
95 0.23
96 0.26
97 0.28
98 0.28
99 0.28
100 0.27
101 0.27
102 0.24
103 0.24
104 0.2
105 0.15
106 0.14
107 0.15
108 0.2
109 0.22
110 0.25
111 0.25