Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2G919

Protein Details
Accession A0A1X2G919    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-119SSSFNKKRWTRSPLEGKRVKHydrophilic
NLS Segment(s)
PositionSequence
106-126KRWTRSPLEGKRVKKIKTGNK
Subcellular Location(s) cyto 13, cyto_nucl 11.833, nucl 9.5, cyto_mito 8.333
Family & Domain DBs
Amino Acid Sequences MMLMLNELIILGVESPVVCGMWVNGFHCELLKMDLPGNGINRLVEIDELELPKSIDDLVKVGLTAQKLLKMKRYIDATTNDAQQCIKKLKLPLCSTSDTSSSFNKKRWTRSPLEGKRVKKIKTGNKIHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.05
8 0.08
9 0.1
10 0.11
11 0.12
12 0.13
13 0.13
14 0.13
15 0.13
16 0.11
17 0.13
18 0.13
19 0.12
20 0.13
21 0.14
22 0.15
23 0.17
24 0.17
25 0.15
26 0.14
27 0.13
28 0.12
29 0.11
30 0.1
31 0.08
32 0.06
33 0.06
34 0.08
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.07
51 0.09
52 0.08
53 0.12
54 0.15
55 0.16
56 0.22
57 0.24
58 0.25
59 0.28
60 0.31
61 0.28
62 0.3
63 0.32
64 0.3
65 0.29
66 0.32
67 0.28
68 0.25
69 0.24
70 0.21
71 0.22
72 0.22
73 0.21
74 0.2
75 0.26
76 0.31
77 0.39
78 0.42
79 0.43
80 0.43
81 0.46
82 0.44
83 0.41
84 0.38
85 0.32
86 0.31
87 0.32
88 0.36
89 0.36
90 0.39
91 0.46
92 0.5
93 0.56
94 0.63
95 0.65
96 0.63
97 0.7
98 0.76
99 0.76
100 0.81
101 0.8
102 0.75
103 0.78
104 0.79
105 0.71
106 0.68
107 0.68
108 0.68
109 0.71