Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2GZD8

Protein Details
Accession A0A1X2GZD8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-123SPSPPPRTHRYSRSPSPRRRSRHRSPDSRRRHRSRSRSRSRSPRRHYRSRSRSPRRSRRSPSPSNEEKTKDDKPKMEKPKEKKKKPSLAFRLIEBasic
NLS Segment(s)
PositionSequence
23-115RGDAPARSPSPPPRTHRYSRSPSPRRRSRHRSPDSRRRHRSRSRSRSRSPRRHYRSRSRSPRRSRRSPSPSNEEKTKDDKPKMEKPKEKKKKP
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd01791  Ubl_UBL5  
Amino Acid Sequences MLRFKKHDKKDLGKADEQRAQLRGDAPARSPSPPPRTHRYSRSPSPRRRSRHRSPDSRRRHRSRSRSRSRSPRRHYRSRSRSPRRSRRSPSPSNEEKTKDDKPKMEKPKEKKKKPSLAFRLIELELNDRLGKKVRVKCSPTDTVGDFKKLAAAQLGTDPNKIVLKKWYKEYKDHITLQDYELNDGMNVELYYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.72
4 0.66
5 0.59
6 0.51
7 0.45
8 0.39
9 0.34
10 0.32
11 0.29
12 0.28
13 0.27
14 0.31
15 0.32
16 0.32
17 0.35
18 0.39
19 0.44
20 0.49
21 0.54
22 0.56
23 0.62
24 0.67
25 0.71
26 0.72
27 0.72
28 0.74
29 0.79
30 0.8
31 0.83
32 0.86
33 0.86
34 0.85
35 0.87
36 0.86
37 0.86
38 0.87
39 0.87
40 0.87
41 0.89
42 0.91
43 0.91
44 0.93
45 0.92
46 0.89
47 0.89
48 0.89
49 0.89
50 0.9
51 0.9
52 0.9
53 0.89
54 0.9
55 0.91
56 0.92
57 0.92
58 0.89
59 0.89
60 0.86
61 0.88
62 0.88
63 0.88
64 0.87
65 0.87
66 0.89
67 0.89
68 0.9
69 0.91
70 0.92
71 0.9
72 0.9
73 0.86
74 0.86
75 0.85
76 0.83
77 0.78
78 0.76
79 0.74
80 0.68
81 0.66
82 0.58
83 0.53
84 0.49
85 0.5
86 0.48
87 0.45
88 0.46
89 0.48
90 0.55
91 0.62
92 0.66
93 0.67
94 0.69
95 0.77
96 0.82
97 0.85
98 0.86
99 0.86
100 0.86
101 0.85
102 0.87
103 0.85
104 0.83
105 0.75
106 0.65
107 0.59
108 0.49
109 0.43
110 0.32
111 0.26
112 0.16
113 0.17
114 0.16
115 0.12
116 0.13
117 0.15
118 0.2
119 0.25
120 0.33
121 0.39
122 0.47
123 0.51
124 0.56
125 0.59
126 0.6
127 0.54
128 0.5
129 0.44
130 0.41
131 0.39
132 0.36
133 0.29
134 0.24
135 0.25
136 0.21
137 0.2
138 0.16
139 0.15
140 0.13
141 0.18
142 0.24
143 0.21
144 0.22
145 0.21
146 0.21
147 0.25
148 0.25
149 0.21
150 0.26
151 0.34
152 0.38
153 0.47
154 0.55
155 0.55
156 0.63
157 0.69
158 0.69
159 0.68
160 0.69
161 0.64
162 0.58
163 0.56
164 0.51
165 0.48
166 0.38
167 0.33
168 0.27
169 0.23
170 0.18
171 0.16
172 0.14
173 0.1