Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2G630

Protein Details
Accession A0A1X2G630   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45GQSHRLPSRRAKNETRRLHSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, E.R. 6, extr 4, mito 3
Family & Domain DBs
Amino Acid Sequences MSTPWLIGLLLLIFECVLSPMRSHTGQSHRLPSRRAKNETRRLHSNMRPLVLGIEFRANIHLVHQVSKICCAYSSYSRTLIFTVRHTIAVFSTVRSLPNLLSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.07
5 0.07
6 0.08
7 0.1
8 0.15
9 0.16
10 0.18
11 0.24
12 0.29
13 0.37
14 0.41
15 0.47
16 0.5
17 0.53
18 0.56
19 0.58
20 0.61
21 0.62
22 0.65
23 0.65
24 0.69
25 0.76
26 0.81
27 0.78
28 0.74
29 0.71
30 0.72
31 0.66
32 0.64
33 0.56
34 0.48
35 0.41
36 0.34
37 0.3
38 0.22
39 0.18
40 0.1
41 0.09
42 0.08
43 0.08
44 0.09
45 0.08
46 0.08
47 0.08
48 0.12
49 0.11
50 0.13
51 0.15
52 0.17
53 0.17
54 0.2
55 0.19
56 0.15
57 0.15
58 0.15
59 0.18
60 0.22
61 0.26
62 0.26
63 0.29
64 0.3
65 0.3
66 0.29
67 0.29
68 0.24
69 0.23
70 0.26
71 0.23
72 0.24
73 0.24
74 0.23
75 0.2
76 0.22
77 0.19
78 0.14
79 0.17
80 0.17
81 0.17
82 0.18
83 0.19