Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GU93

Protein Details
Accession A0A1X2GU93    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-80GAPFFGKEQKKKKKINLEVEADHydrophilic
NLS Segment(s)
PositionSequence
68-71KKKK
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004202  COX7C/Cox8  
IPR036636  COX7C/Cox8_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02935  COX7C  
Amino Acid Sequences MFANTVARSAIRSRLATRQVMRSDLYHFENANGQNIPFNTKNRAGLAIKMTLYLGAGFGAPFFGKEQKKKKKINLEVEADGDTVFSKAATGNCKCNRNHNKKERMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.46
4 0.47
5 0.49
6 0.46
7 0.46
8 0.44
9 0.37
10 0.35
11 0.32
12 0.32
13 0.27
14 0.24
15 0.23
16 0.26
17 0.26
18 0.25
19 0.21
20 0.18
21 0.17
22 0.18
23 0.22
24 0.19
25 0.21
26 0.23
27 0.24
28 0.26
29 0.24
30 0.28
31 0.24
32 0.24
33 0.24
34 0.21
35 0.19
36 0.17
37 0.16
38 0.12
39 0.11
40 0.08
41 0.06
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.03
48 0.04
49 0.05
50 0.12
51 0.16
52 0.24
53 0.35
54 0.46
55 0.55
56 0.63
57 0.71
58 0.75
59 0.81
60 0.83
61 0.81
62 0.76
63 0.69
64 0.62
65 0.55
66 0.44
67 0.34
68 0.23
69 0.15
70 0.09
71 0.07
72 0.05
73 0.05
74 0.07
75 0.1
76 0.17
77 0.2
78 0.3
79 0.37
80 0.44
81 0.45
82 0.54
83 0.63
84 0.66
85 0.75
86 0.75